Tested Applications
| Positive WB detected in | LPS and Protein transport inhibitor treated HUVEC cells |
| Positive IP detected in | LPS and Protein transport inhibitor treated HUVEC cells |
| Positive IF/ICC detected in | LPS and Brefeldin A treated HUVEC cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 5 publications below |
| WB | See 532 publications below |
| IHC | See 190 publications below |
| IF | See 80 publications below |
| ELISA | See 5 publications below |
Product Information
21865-1-AP targets IL-6 in WB, IHC, IF/ICC, IP, Neutralization, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, pig, rabbit, canine, bovine, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag10565 Product name: Recombinant human IL-6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-212 aa of BC015511 Sequence: MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM Predict reactive species |
| Full Name | interleukin 6 (interferon, beta 2) |
| Calculated Molecular Weight | 212 aa, 24 kDa |
| Observed Molecular Weight | 20 kDa |
| GenBank Accession Number | BC015511 |
| Gene Symbol | IL6 |
| Gene ID (NCBI) | 3569 |
| ENSEMBL Gene ID | ENSG00000136244 |
| RRID | AB_11142677 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P05231 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Interleukin-6 (IL-6) is an interleukin that acts as both a pro-inflammatory and anti-inflammatory cytokine. IL-6 protein is secreted by a variety of cell types including T cells and macrophages as phosphorylated and variably glycosylated molecule. IL-6 plays an essential role in the final differentiation of B-cells into Ig-secreting cells involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. IL-6 is also considered a myokine, a cytokine produced from muscle, and is elevated in response to muscle contraction. IL-6 has been shown to interact with interleukin-6 receptor and glycoprotein 130. Additionally, IL-6 is involved in hematopoiesis, bone metabolism, and cancer progression, and has been defined an essential role in directing transition from innate to acquired immunity.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for IL-6 antibody 21865-1-AP | Download protocol |
| IP protocol for IL-6 antibody 21865-1-AP | Download protocol |
| WB protocol for IL-6 antibody 21865-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Biotechnol Magnify is a universal molecular anchoring strategy for expansion microscopy | ||
J Hematol Oncol FFAR2 expressing myeloid-derived suppressor cells drive cancer immunoevasion | ||
Cancer Cell Cathepsin C promotes breast cancer lung metastasis by modulating neutrophil infiltration and neutrophil extracellular trap formation. | ||
Bioact Mater Multifunctional hydrogel encapsulated with baicalin for full-layer regeneration of drug-resistant bacteria-infected wounds after radiotherapy | ||
Bioact Mater A bioactive composite hydrogel dressing that promotes healing of both acute and chronic diabetic skin wounds | ||
Bioact Mater Genetically engineered M2-like macrophage-derived exosomes for P. gingivalis-suppressed cementum regeneration: From mechanism to therapy |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Udesh (Verified Customer) (04-19-2023) | Lowest most band corresponds to IL-6
![]() |
FH Elizabeth (Verified Customer) (12-03-2018) |
|






