IGF2BP2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• IGF2BP2 Polyclonal antibody (11601-1-AP)

• Featured Product
• KD/KO Validated

IGF2BP2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 11601-1-AP Copied!

Publications (270)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA

Synonyms

IGF2 mRNA-binding protein 2, IGF-II mRNA-binding protein 2, IMP2, IMP-2, insulin like growth factor 2 mRNA binding protein 2

• 

  WB analysis using 11601-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11601-1-AP (IGF2BP2 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human heart using 11601-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 11601-1-AP (IGF2BP2 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of COLO 320 using 11601-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 11601-1-AP (IGF2BP2 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human kidney using 11601-1-AP

  human kidney tissue were subjected to SDS PAGE followed by western blot with 11601-1-AP (IGF2BP2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HEK-293 using 11601-1-AP

  IP result of anti-IGF2BP2 (IP:11601-1-AP, 3ug; Detection:11601-1-AP 1:500) with HEK-293 cells lysate 1000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 11601-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 11601-1-AP (IGF2BP2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 11601-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 11601-1-AP (IGF2BP2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 11601-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11601-1-AP (IGF2BP2 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 11601-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11601-1-AP (IGF2BP2 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse stomach using 11601-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 11601-1-AP (IGF2BP2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse stomach using 11601-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 11601-1-AP (IGF2BP2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 11601-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11601-1-AP (IGF2BP2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 11601-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11601-1-AP (IGF2BP2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 11601-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11601-1-AP (IGF2BP2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 11601-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using IGF2BP2 antibody (11601-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for IGF2BP2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, mouse kidney tissue, rat kidney tissue, human kidney tissue, human heart tissue, COLO 320 cells
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: human pancreas cancer tissue, human breast cancer tissue, human colon cancer tissue, mouse stomach tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11601-1-AP targets IGF2BP2 in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2142

  Product name: Recombinant human IGF2BP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-341 aa of BC021290

  Sequence: MNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSGKVELHGKIMEVDYSVSKKLRSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTETAVVNVTYATREEAKIAMEKLSGHQFENYSFKISYIPDEEVSSPSPPQRAQRGDHSSREQGHAPGGTSQARQIDFPLRILVPTQFVGAIIGKEGLTIKNITKQTQSRVDIHRKENSGAAEKPVTIHATPEGTSEACRMILEIMQKEADETKLAEEIPLKILAHNGLVGRLIGKEGRNLKKIEHETGTKITISSLQDLSIYNPERTITVKGTVEACASAEIEIM

• Full Name: insulin-like growth factor 2 mRNA binding protein 2
• Calculated Molecular Weight: 65 kDa
• Observed Molecular Weight: 55-65 kDa
• GenBank Accession Number: BC021290
• Gene Symbol: IGF2BP2
• Gene ID (NCBI): 10644
• RRID: AB_2122672
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y6M1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Insulin-like growth factor 2 mRNA-binding protein 2(IGF2BP2), ia a member of a family of mRNA binding protein, which can bind to several mammalian cells' mRNAs. Thus it may involve in the regulation of translation of mRNA. IGF2BP2's polymorphisms is risk factor for developing type 2 diabetes. This antibody raise against part of N-terminus of human IGF2BP2. IGF2BP2 has some isoforms with the MW of 54-66 kDa. Some literature has reported that multiple bands can be detected (PMID: 22427968, 36322753, 23069990).

Publications

What published studies show

Anti-IGF2BP2 antibody (Cat# 11601-1-AP) has 270 total citations published in high-impact journals including Cell, Nature Communications, Molecular Cancer, Cancer Research, Cell Death & Disease, Oncogene, Clinical & Translational Medicine, and International Journal of Biological Sciences. Associated research fields encompass m6A epitranscriptomics, diverse cancer types (colorectal, lung, breast, liver, gastric, pancreatic, thyroid, prostate), metabolic regulation, neuroinflammation, fibrosis, ferroptosis, and immune cell modulation.

Automatically generated from the 270 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	J Hematol Oncol; N6-methyladenosine reader IMP2 stabilizes the ZFAS1/OLA1 axis and activates the Warburg effect: implication in colorectal cancer.; Authors - Senxu Lu ; KD Validated
human	WB	Cell; An in vitro system to silence mitochondrial gene expression.; Authors - Luis Daniel Cruz-Zaragoza
	RIP	Cell; Synonymous mutations promote tumorigenesis by disrupting m6A-dependent mRNA metabolism; Authors - Yiheng Lan
human	WB	Cell; FOCAS: Transcriptome-wide screening of individual m(6)A sites functionally dissects epitranscriptomic control of gene expression in cancer.; Authors - Xinning Zhang
human	WB	Mol Cancer; CircEZH2/miR-133b/IGF2BP2 aggravates colorectal cancer progression via enhancing the stability of m6A-modified CREB1 mRNA.; Authors - Bing Yao
human	WB,RIP,IF	Mol Cancer; M6A-Methylated circRAPGEF5 drives lung adenocarcinoma progression and metastasis via IGF2BP2/NUP160-mediated autophagy suppression; Authors - Liqun Ling ; KD Validated

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

One reviewer rated this antibody 5 out of 5 stars, using a sample lot on Hek293 cells for Western Blot at a 1:1000 dilution. They described the product as having good quality and specificity, indicating a positive experience with its performance in their application.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Parisa (Verified Customer) (06-13-2022)

good quality and specify.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Hek293