ICAM-2/CD102 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ICAM-2/CD102 Polyclonal antibody (10121-2-AP)

• Featured Product
• KD/KO Validated

ICAM-2/CD102 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10121-2-AP Copied!

Publications (7)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, ELISA

Synonyms

CD102, ICAM2, ICAM 2, ICAM-2

• 

  WB analysis of Jurkat using 10121-2-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 10121-2-AP (ICAM2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 10121-2-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10121-2-AP (ICAM2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of RAW 264.7 using 10121-2-AP

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 10121-2-AP (ICAM2 Antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 10121-2-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 10121-2-AP (ICAM2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 10121-2-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10121-2-AP (ICAM2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 10121-2-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10121-2-AP (ICAM2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse spleen using 10121-2-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 10121-2-AP (ICAM2 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 10121-2-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10121-2-AP (ICAM2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 10121-2-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10121-2-AP (ICAM2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ICAM-2/CD102 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells, HEK-293 cells, mouse brain tissue, RAW 264.7 cells
• Positive IHC detected in: human breast cancer tissue, mouse spleen tissue, human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10121-2-AP targets ICAM-2/CD102 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0165

  Product name: Recombinant human ICAM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 104-275 aa of BC003097

  Sequence: SNVSVYQPPRQVILTLQPTLVAVGKSFTIECRVPTVEPLDSLTLFLFRGNETLHYETFGKAAPAPQEATATFNSTADREDGHRNFSCLAVLDLMSRGGNIFHKHSAPKMLEIYEPVSDSQMVIIVTVVSVLLSLFVTSVLLCFIFGQHLRQQRMGTYGVRAAWRRLPQAFRP

• Full Name: intercellular adhesion molecule 2
• Calculated Molecular Weight: 31 kDa
• Observed Molecular Weight: 55-80 kDa
• GenBank Accession Number: BC003097
• Gene Symbol: ICAM2/CD102
• Gene ID (NCBI): 3384
• RRID: AB_2233415
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P13598
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ICAM2 is a cell adhesion protein having important roles in cell migration, especially during inflammation when leukocytes cross the endothelium. Initially described as a receptor for lymphocyte function-associated antigen-1 (LFA1), ICAM2 may play a role in lymphocyte recirculation by blocking LFA-1-dependent cell adhesion. It mediates adhesive interactions important for antigen-specific immune response, NK-cell mediated clearance, lymphocyte recirculation, and other cellular interactions important for immune response and surveillance. ICAM2 has six N-linked glycosylation sites at amino acids (asparagines) 47, 82, 105, 153, 178 and 187. This antibody got 55-80 kDa in western blotting maybe due to glycosylation.

Publications

What published studies show

The anti-ICAM-2 (CD102) antibody, catalog number 10121-2-AP, has 7 total citations published in J Neuroinflammation, Stem Cell Research & Therapy, Frontiers in Cellular and Infection Microbiology, Journal of Ovarian Research, Lupus Science & Medicine, Human Pathology, and PLoS One. Research fields span neuroinflammation, ferroptosis and efferocytosis, viral neuroinvasion, endometriosis, lupus nephritis, plasma cell mastitis, and neuroblastoma. Applications include WB, IF, and IHC in human and mouse samples.

Automatically generated from the 7 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	J Neuroinflammation; Fatty acid-binding protein 4 drives microglia-mediated neuroinflammation through promoting S100A9 expression and lipid droplet accumulation after intracerebral hemorrhage.; Authors - Jiaqing He
human	IF	Stem Cell Res Ther; MSCs promote the efferocytosis of large peritoneal macrophages to eliminate ferroptotic monocytes/macrophages in the injured endometria; Authors - Jiali Wang
mouse	WB	Front Cell Infect Microbiol; Brain Microvascular Endothelial Cell-Derived HMGB1 Facilitates Monocyte Adhesion and Transmigration to Promote JEV Neuroinvasion.; Authors - Song-Song Zou
human	IHC	J Ovarian Res; The presence of living endometrial cells in ovarian endometriotic cyst fluid may contribute to the recurrence of endometriosis after surgical excision of endometriomas; Authors - Xinxin Xu
human	WB,IHC,IF	Lupus Sci Med; Proteomics uncovers ICAM2 (CD102) as a novel serum biomarker of proliferative lupus nephritis; Authors - Zhengyong Li ; KD Validated
human	IHC	Hum Pathol; Intercellular adhesion molecule 1/2 and E-selectin in plasma cell mastitis: immunohistochemical study of 35 cases.; Authors - Yu Dong