• Featured Product
  • KD/KO Validated

HNRNPA1 Polyclonal antibody

HNRNPA1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 11176-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA

HNRPA1, hnRNP core protein A1, hnRNP A1, Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed, Helix-destabilizing protein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, mouse colon tissue, K-562 cells, Neuro-2a cells, C6 cells
Positive IHC detected inmouse pancreas tissue, human breast cancer tissue, human colon tissue, human colon cancer tissue, human liver cancer tissue, human lung cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11176-1-AP targets HNRNPA1 in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse, rat, pig, zebrafish
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1656

Product name: Recombinant human HNRNPA1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-320 aa of BC009600

Sequence: MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF

Predict reactive species
Full Name heterogeneous nuclear ribonucleoprotein A1
Calculated Molecular Weight 34 kDa
Observed Molecular Weight 34, 40 kDa
GenBank Accession NumberBC009600
Gene Symbol HNRNPA1
Gene ID (NCBI) 3178
RRIDAB_2117177
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP09651
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

In eukaryotic cells, nascent RNA polymerase II transcripts are associated in the nucleus with specific proteins to form ribonucleoprotein complexes called HNRP or 40S. Protein moiety of the HNRP particle has 6 major components called core proteins, and HNRPA1 is one of them. hnRNP A1 is a multifunctional RNA binding protein which is involved in pre-mRNA splicing, export of mature transcripts from the nucleus, mRNA turnover, and internal ribosome entry site (IRES)-mediated translation. HNRNPA1 has three isoforms with MW 30 kDa, 34 kDa and 39 kDa.

Protocols

Product Specific Protocols
IF protocol for HNRNPA1 antibody 11176-1-APDownload protocol
IHC protocol for HNRNPA1 antibody 11176-1-APDownload protocol
WB protocol for HNRNPA1 antibody 11176-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell

In vivo structural characterization of the SARS-CoV-2 RNA genome identifies host proteins vulnerable to repurposed drugs.

Authors - Lei Sun
mouseWB

Mol Cell

Zc3h13 Regulates Nuclear RNA m6A Methylation and Mouse Embryonic Stem Cell Self-Renewal.

Authors - Jing Wen
humanWB

Mol Cell

A Peptide Encoded by a Putative lncRNA HOXB-AS3 Suppresses Colon Cancer Growth.

Authors - Jin-Zhou Huang
  • KD Validated
WB

Nat Commun

Profiling PRMT methylome reveals roles of hnRNPA1 arginine methylation in RNA splicing and cell growth.

Authors - Wen-Juan Li
  • KD Validated
pigWB

Mol Biol Evol

Long-term artificial selection reveals a role of TCTP in autophagy in mammalian cells.

Authors - Ke Chen
humanWB,IF

J Cell Biol

An APEX2 proximity ligation method for mapping interactions with the nuclear lamina.

Authors - Joseph R Tran

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Juliette (Verified Customer) (07-09-2025)

Works very well, strong signal.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:10 000
  • Cell Tissue Type: HeLa
FH

CAITLIN (Verified Customer) (03-04-2025)

Great antibody, very strong staining, so would probably use at 1:10,000 or closer tot he suggested dilution but worked great

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: A2780
FH

Zhongwen (Verified Customer) (09-25-2023)

Good quality. It is easy for you to find the target bind.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK293T
HNRNPA1 Antibody Western Blot validation (1:1000 dilution) in HEK293T (Cat no:11176-1-AP)
FH

Katie (Verified Customer) (04-08-2022)

Works nicely for IF in primary CD4+ T cells. 2hr Primary incubation at 37 and 2hr secondary incubation at 37oc 1:1000.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:50
Loading...
||
New chat Able
正在加载,请稍候...