HINT1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• HINT1 Polyclonal antibody (10717-1-AP)

• Featured Product
• KD/KO Validated

HINT1 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 10717-1-AP Copied!

Publications (20)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, IP, CoIP, ELISA

Synonyms

HINT, HINT1, PKCI 1, PKCI1, PRKCNH1, Protein kinase C inhibitor 1

• 

  WB analysis using 10717-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10717-1-AP (HINT1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat brain using 10717-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 10717-1-AP (HINT1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat thymus using 10717-1-AP

  rat thymus tissue were subjected to SDS PAGE followed by western blot with 10717-1-AP (HINT1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse brain using 10717-1-AP

  IP result of anti-HINT1 (IP:10717-1-AP, 3ug; Detection:10717-1-AP 1:500) with mouse brain tissue lysate 7500ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 10717-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10717-1-AP (HINT1 antibody) at dilution of 1:600 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 10717-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10717-1-AP (HINT1 antibody) at dilution of 1:600 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 10717-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10717-1-AP (HINT1 antibody) at dilution of 1:600 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 10717-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10717-1-AP (HINT1 antibody) at dilution of 1:600 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for HINT1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells, rat brain tissue, rat thymus tissue, K-562 cells, Raji cells
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human colon cancer tissue, human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:300-1:1200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10717-1-AP targets HINT1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, chicken
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1142

  Product name: Recombinant human HINT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-126 aa of BC007090

  Sequence: MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG

• Full Name: histidine triad nucleotide binding protein 1
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC007090
• Gene Symbol: HINT1
• Gene ID (NCBI): 3094
• RRID: AB_2248272
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P49773
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HINT1(Histidine triad nucleotide-binding protein 1) is also named as HINT, PKCI1, PRKCNH1,which is a member of the histidine triad (HIT) family, highly conserved in diverse species and ubiquitously expressed in mammalian tissues.It hydrolyzes adenosine 5'-monophosphoramidate substrates such as AMP-morpholidate, AMP-N-alanine methyl ester, AMP-alpha-acetyl lysine methyl ester and AMP-NH2.This antibody is specific to HINT1.

Publications

What published studies show

The HINT1 antibody (Cat# 10717-1-AP) has 20 citations published in journals including Nature Communications, Cancer Letters, Oncogene, Journal of Biological Chemistry, Molecular Metabolism, Journal of Proteome Research, and others. Research fields span oncology (hepatocellular carcinoma, gastric cancer, melanoma, breast cancer), cardiology, neuroscience, pharmacology, proteomics, and cell metabolism.

Automatically generated from the 20 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Nat Commun; Second messenger Ap4A polymerizes target protein HINT1 to transduce signals in FcεRI-activated mast cells.; Authors - Jing Yu
human,mouse	WB,IHC	Cancer Lett; Silencing of Hint1, a novel tumor suppressor gene, by promoter hypermethylation in hepatocellular carcinoma.; Authors - Zhang Yu-Jing YJ
		Oncogene; Post-translational modification of HINT1 mediates activation of MITF transcriptional activity in human melanoma cells.; Authors - A Motzik
human	WB	J Med Chem; A Chemical Strategy for Intracellular Arming of an Endogenous Broad-Spectrum Antiviral Nucleotide; Authors - Kellan T. Passow
human	WB,IHC	Int J Oncol; Clinical significance of expression of Hint1 and potential epigenetic mechanism in gastric cancer.; Authors - Huang Huaying H
human	WB	Biochem Pharmacol; The role of the Hint1 protein in the metabolism of phosphorothioate oligonucleotides drugs and prodrugs, and the release of H2S under cellular conditions.; Authors - Agnieszka Krakowiak