GRPEL1 Polyclonal antibody

• 

  WB analysis of MCF-7 using 12720-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 12720-1-AP (GRPEL1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 12720-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12720-1-AP (GRPEL1 antibody) at dilution of 1:12000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of MCF-7 using 12720-1-AP

  IP result of anti-GRPEL1 (IP:12720-1-AP, 4ug; Detection:12720-1-AP 1:10000) with MCF-7 cells lysate 1000 ug.

• 

  IHC staining of human bowen disease using 12720-1-AP

  Immunohistochemical analysis of paraffin-embedded human bowen disease slide using 12720-1-AP (GRPEL1 antibody) at dilution of 1:2400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human bowen disease using 12720-1-AP

  Immunohistochemical analysis of paraffin-embedded human bowen disease slide using 12720-1-AP (GRPEL1 antibody) at dilution of 1:2400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 12720-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using GRPEL1 antibody (12720-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).

• 

  IF Staining of HepG2 using 12720-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using GRPEL1 antibody (12720-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).

• Featured Product
• KD/KO Validated

GRPEL1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 12720-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

GREPEL1, HMGE, Mt GrpE#1, Mt-GrpE#1

---

Tested Applications

• Positive WB detected in: MCF-7 cells, HEK-293T cells
• Positive IP detected in: MCF-7 cells
• Positive IHC detected in: human bowen disease tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:1200-1:4800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 4 publications below

Product Information

12720-1-AP targets GRPEL1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3415

  Product name: Recombinant human GRPEL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-217 aa of BC024242

  Sequence: MAAQCVRLARRSLPALALSLRPSPRLLCTATKQKNSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALADTENLRQRSQKLVEEAKLYGIQAFCKDLLEVADVLEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKEA

• Full Name: GrpE-like 1, mitochondrial (E. coli)
• Calculated Molecular Weight: 217 aa, 24 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC024242
• Gene Symbol: GRPEL1
• Gene ID (NCBI): 80273
• RRID: AB_2114331
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HAV7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; The mitochondrial DNAJC co-chaperone TCAIM reduces α-ketoglutarate dehydrogenase protein levels to regulate metabolism; Authors - Wang Jiahui ; KD Validated
human	WB	Nat Commun; LONP1 and mtHSP70 cooperate to promote mitochondrial protein folding.; Authors - Chun-Shik Shin
human	WB	Nat Commun; Protein import motor complex reacts to mitochondrial misfolding by reducing protein import and activating mitophagy; Authors - Jonas Benjamin Michaelis
human	WB	EBioMedicine; The LIV-1-GRPEL1 axis adjusts cell fate during anti-mitotic agent-damaged mitosis.; Authors - Pingbo Chen