Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

GOLPH3 Polyclonal antibody

GOLPH3 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

MIDAS, GPP34, GOPP1, GOLPH 3, Golgi phosphoprotein 3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for GOLPH3 in ?

Tested Applications

Positive WB detected inHeLa cells, mouse lung tissue, rat testis tissue, mouse testis tissue
Positive IP detected inmouse testis tissue
Positive IHC detected inhuman colon cancer tissue, human placenta tissue, human colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

19112-1-AP targets GOLPH3 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5443

Product name: Recombinant human GOLPH3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-298 aa of BC033725

Sequence: MTSLTQRSSGLVQRRTEASRNAADKERAAGGGAGSSEDDAQSRRDEQDDDDKGDSKETRLTLMEEVLLLGLKDREGYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHVKETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIKQRLIKKVQEAVLDKWVNDPHRMDRRLLALIYLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK

Predict reactive species
Full Name golgi phosphoprotein 3 (coat-protein)
Calculated Molecular Weight 298 aa, 34 kDa
Observed Molecular Weight 34 kDa
GenBank Accession NumberBC033725
Gene Symbol GOLPH3
Gene ID (NCBI) 64083
RRIDAB_2113342
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9H4A6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GOLPH3 (also called GPP34, GMx33, MIDAS, or yeast Vps74p) is a 34-kDa Golgi-associated protein conserved from yeast to human. GOLPH3 binds to PtdIns(4)P-rich trans-Golgi membranes and MYO18A conveying a tensile force required for efficient tubule and vesicle formation (PMID: 19837035). GOLPH3 has been recently demonstrated as a novel oncoprotein amplified in various types of human malignancies, including melanoma, breast, non-small cell lung cancer, gliomas and connective tissue tumors (PMID:19553991; 23006319; 21499727; 22745132). Enhanced activation of mTOR signalling represents a molecular basis for the oncogenic activity of GOLPH3 (PMID: 19553991).

Protocols

Product Specific Protocols
IF protocol for GOLPH3 antibody 19112-1-APDownload protocol
IHC protocol for GOLPH3 antibody 19112-1-APDownload protocol
IP protocol for GOLPH3 antibody 19112-1-APDownload protocol
WB protocol for GOLPH3 antibody 19112-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Anti-GOLPH3 antibody (Cat# 19112-1-AP) has accumulated 35 citations published in journals including Gastroenterology, Cancer Research, Cell Reports, EMBO Reports, Cell Death & Disease, Theranostics, and Free Radical Biology and Medicine. Associated research fields encompass oncology (colorectal, gastric, lung, ovarian, bladder, breast, prostate, and renal cancers), Golgi stress and organelle biology, inflammation, autophagy, epithelial-mesenchymal transition, ferroptosis, protein glycosylation, and key signaling pathways including Wnt/β-catenin and mTOR.

SpeciesApplicationTitle
mouseWB,IF,IP

Gastroenterology

Impaired glycosylation of gastric mucins drives gastric tumorigenesis and serves as a novel therapeutic target

Authors - Junya Arai
  • KD Validated
humanWB

Cancer Res

A Novel Micropeptide Encoded by Y-Linked LINC00278 Links Cigarette Smoking and AR Signaling in Male Esophageal Squamous Cell Carcinoma.

Authors - Siqi Wu
human,mouseWB,IHC,IF

Theranostics

miR34a/GOLPH3 Axis abrogates Urothelial Bladder Cancer Chemoresistance via Reduced Cancer Stemness.

Authors - Qing Zhang
  • KD Validated
humanWB

J Exp Clin Cancer Res

STK25-induced inhibition of aerobic glycolysis via GOLPH3-mTOR pathway suppresses cell proliferation in colorectal cancer.

Authors - Fan Wu
human,mouseWB,IHC,IF

Cell Death Dis

GOLPH3 promotes endotoxemia-induced liver and kidney injury through Golgi stress-mediated apoptosis and inflammatory response

Authors - Theodomir Dusabimana
  • KD Validated
humanWB

Cell Death Dis

GOLPH3/CKAP4 promotes metastasis and tumorigenicity by enhancing the secretion of exosomal WNT3A in non-small-cell lung cancer

Authors - Jun-Wei Song

Reviews

    4.0 out of 5
Add a review

1 verified customer reviews

What customers say

One reviewer (Boyan Zhang, April 2023) gave this antibody a 4-star rating for immunofluorescence. They found it "fairly good for IF" but noted that the results were not as clear as the images shown in the product booklet. Overall, the feedback suggests acceptable performance with room for improvement in signal clarity compared to manufacturer-expected results.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Boyan (Verified Customer) (04-17-2023)

fairly good for IF, but not as clear as the images in its booklet

  • Applications: Immunofluorescence
Loading...
||
New chat

Able™

正在加载,请稍候...