Tested Applications
| Positive WB detected in | HeLa cells, mouse lung tissue, rat testis tissue, mouse testis tissue |
| Positive IP detected in | mouse testis tissue |
| Positive IHC detected in | human colon cancer tissue, human placenta tissue, human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
19112-1-AP targets GOLPH3 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5443 Product name: Recombinant human GOLPH3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-298 aa of BC033725 Sequence: MTSLTQRSSGLVQRRTEASRNAADKERAAGGGAGSSEDDAQSRRDEQDDDDKGDSKETRLTLMEEVLLLGLKDREGYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHVKETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIKQRLIKKVQEAVLDKWVNDPHRMDRRLLALIYLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK Predict reactive species |
| Full Name | golgi phosphoprotein 3 (coat-protein) |
| Calculated Molecular Weight | 298 aa, 34 kDa |
| Observed Molecular Weight | 34 kDa |
| GenBank Accession Number | BC033725 |
| Gene Symbol | GOLPH3 |
| Gene ID (NCBI) | 64083 |
| RRID | AB_2113342 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H4A6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GOLPH3 (also called GPP34, GMx33, MIDAS, or yeast Vps74p) is a 34-kDa Golgi-associated protein conserved from yeast to human. GOLPH3 binds to PtdIns(4)P-rich trans-Golgi membranes and MYO18A conveying a tensile force required for efficient tubule and vesicle formation (PMID: 19837035). GOLPH3 has been recently demonstrated as a novel oncoprotein amplified in various types of human malignancies, including melanoma, breast, non-small cell lung cancer, gliomas and connective tissue tumors (PMID:19553991; 23006319; 21499727; 22745132). Enhanced activation of mTOR signalling represents a molecular basis for the oncogenic activity of GOLPH3 (PMID: 19553991).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for GOLPH3 antibody 19112-1-AP | Download protocol |
| IHC protocol for GOLPH3 antibody 19112-1-AP | Download protocol |
| IP protocol for GOLPH3 antibody 19112-1-AP | Download protocol |
| WB protocol for GOLPH3 antibody 19112-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-GOLPH3 antibody (Cat# 19112-1-AP) has accumulated 35 citations published in journals including Gastroenterology, Cancer Research, Cell Reports, EMBO Reports, Cell Death & Disease, Theranostics, and Free Radical Biology and Medicine. Associated research fields encompass oncology (colorectal, gastric, lung, ovarian, bladder, breast, prostate, and renal cancers), Golgi stress and organelle biology, inflammation, autophagy, epithelial-mesenchymal transition, ferroptosis, protein glycosylation, and key signaling pathways including Wnt/β-catenin and mTOR.
| Species | Application | Title |
|---|---|---|
Gastroenterology Impaired glycosylation of gastric mucins drives gastric tumorigenesis and serves as a novel therapeutic target
| ||
Cancer Res A Novel Micropeptide Encoded by Y-Linked LINC00278 Links Cigarette Smoking and AR Signaling in Male Esophageal Squamous Cell Carcinoma. | ||
Theranostics miR34a/GOLPH3 Axis abrogates Urothelial Bladder Cancer Chemoresistance via Reduced Cancer Stemness.
| ||
J Exp Clin Cancer Res STK25-induced inhibition of aerobic glycolysis via GOLPH3-mTOR pathway suppresses cell proliferation in colorectal cancer. | ||
Cell Death Dis GOLPH3 promotes endotoxemia-induced liver and kidney injury through Golgi stress-mediated apoptosis and inflammatory response
| ||
Cell Death Dis GOLPH3/CKAP4 promotes metastasis and tumorigenicity by enhancing the secretion of exosomal WNT3A in non-small-cell lung cancer |
Reviews
What customers say
One reviewer (Boyan Zhang, April 2023) gave this antibody a 4-star rating for immunofluorescence. They found it "fairly good for IF" but noted that the results were not as clear as the images shown in the product booklet. Overall, the feedback suggests acceptable performance with room for improvement in signal clarity compared to manufacturer-expected results.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Boyan (Verified Customer) (04-17-2023) | fairly good for IF, but not as clear as the images in its booklet
|
