GINS3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GINS3 Polyclonal antibody (15651-1-AP)

GINS3 Polyclonal Antibody for WB, IP, ELISA

Cat No. 15651-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, ELISA

Synonyms

PSF3, GINS complex subunit 3

• 

  WB analysis of Jurkat using 15651-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 15651-1-AP (GINS3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 15651-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 15651-1-AP (GINS3 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of Jurkat using 15651-1-AP

  IP result of anti-GINS3 (IP:15651-1-AP, 4ug; Detection:15651-1-AP 1:300) with Jurkat cells lysate 3400ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: Jurkat cells, NIH/3T3 cells
• Positive IP detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15651-1-AP targets GINS3 in WB, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8247

  Product name: Recombinant human GINS3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-216 aa of BC005879

  Sequence: MSEAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFLERSAGAETDNAVPQGSKLELPLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLLQTFIGRFRRIMDSSQNAYNEDTSALVARLDEMERGLFQTGQKGLNDFQCWEKGQASQITASNLVQNYKKRKFTDMED

• Full Name: GINS complex subunit 3 (Psf3 homolog)
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC005879
• Gene Symbol: GINS3
• Gene ID (NCBI): 64785
• RRID: AB_2247477
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BRX5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GINS3 (GINS Complex Subunit 3), also known as PSF3, serves as a subunit of the GINS heterotetrameric complex (GINS1/2/3/4). GINS3 is essential for the initiation of DNA replication and progression of replication forks. GINS3 is significantly upregulated in liver hepatocellular carcinoma, where it correlates with poor prognosis, methylation alterations, and immune escape, and has been proposed as a potential diagnostic biomarker.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Mol Cell; Polε Instability Drives Replication Stress, Abnormal Development, and Tumorigenesis.; Authors - Roberto Bellelli
human	WB	J Clin Invest; Inherited GINS1 deficiency underlies growth retardation along with neutropenia and NK cell deficiency.; Authors - Julien Cottineau
human	WB	JCI Insight; Partial loss-of-function mutations in GINS4 lead to NK cell deficiency with neutropenia; Authors - Matilde I. Conte
		Nat Commun; Nuclear compartmentalization at the G1/S transition plays a key role in DNA replication control.; Authors - Asami Oji
human	WB	Cell Rep; Loss of POLE3-POLE4 unleashes replicative gap accumulation upon treatment with PARP inhibitors; Authors - Bethany Rebekah Hill