GBF1 Polyclonal antibody

• 

  WB analysis of HeLa using 25183-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 25183-1-AP (GBF1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human prostate cancer using 25183-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 25183-1-AP (GBF1 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 25183-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 25183-1-AP (GBF1 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 25183-1-AP

  Immunofluorescent analysis of HeLa cells using 25183-1-AP (GBF1 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

GBF1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 25183-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

ARF1GEF, BFA resistant GEF 1, GBF1, KIAA0248

---

Tested Applications

• Positive WB detected in: HeLa cells
• Positive IHC detected in: human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below
• IF: See 1 publications below

Product Information

25183-1-AP targets GBF1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16579

  Product name: Recombinant human GBF1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1506-1855 aa of BC117681

  Sequence: ASIYSSWAEEQRHLETGGQKIEADSRTLWAHCWCPLLQGIACLCCDARRQVRMQALTYLQRALLVHDLQKLDALEWESCFNKVLFPLLTKLLENISPADVGGMEETRMRASTLLSKVFLQHLSPLLSLSTFAALWLTILDFMDKYMHAGSSDLLSEAIPESLKNMLLVMDTAEIFHSADARGGGPSALWEITWERIDCFLPHLRDELFKQTVIQDPMPMEPQGQKPLASAHLTSAAGDTRTPGHPPPPEIPSELGACDFEKPESPRAASSSSPGSPVASSPSRLSPTPDGPPPLAQPPLILQPLASPLQVGVPPMTLPIILNPALIEATSPVPLLATPRPTDPIPTSEVN

• Full Name: golgi-specific brefeldin A resistant guanine nucleotide exchange factor 1
• Calculated Molecular Weight: 1859 aa, 206 kDa
• Observed Molecular Weight: 206 kDa
• GenBank Accession Number: BC117681
• Gene Symbol: GBF1
• Gene ID (NCBI): 8729
• RRID: AB_2879948
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92538
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; TBC1D23 mediates Golgi-specific LKB1 signaling; Authors - Yingfeng Tu
human	WB	PLoS Pathog; Enterovirus 71 protease 2Apro and 3Cpro differentially inhibit the cellular endoplasmic reticulum-associated degradation (ERAD) pathway via distinct mechanisms, and enterovirus 71 hijacks ERAD component p97 to promote its replication.; Authors - Tao Wang
human	WB	Sci Rep; The Golgi protein ACBD3 facilitates Enterovirus 71 replication by interacting with 3A.; Authors - Xiaobo Lei ; KD Validated
human	IF	J Virol; Enterovirus 3A protein disrupts endoplasmic reticulum homeostasis through interaction with GBF1; Authors - Junki Hirano