FLAD1 Polyclonal antibody

• 

  WB analysis of HEK-293 using 14118-1-AP

  WB result of FLAD1 antibody (14118-1-AP; 1:1500; incubated at room temperature for 1.5 hours) with sh-Control and sh-FLAD1 transfected HEK-293 cells.

• 

  WB analysis of K-562 using 14118-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 14118-1-AP (FLAD1 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 14118-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14118-1-AP (FLAD1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 14118-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 14118-1-AP (FADS antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat liver using 14118-1-AP

  rat liver tissue were subjected to SDS PAGE followed by western blot with 14118-1-AP (FADS antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of K-562 using 14118-1-AP

  IP result of anti-FLAD1 (IP:14118-1-AP, 4ug; Detection:14118-1-AP 1:1000) with K-562 cells lysate 2400 ug.

• 

  IF Staining of HepG2 using 14118-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using FLAD1 antibody (14118-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

FLAD1 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 14118-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, CoIP, ELISA

Synonyms

FADS, FAD1, FAD synthase region, FAD synthase, FAD pyrophosphorylase

---

Tested Applications

• Positive WB detected in: K-562 cells, HEK-293 cells, HepG2 cells, rat liver tissue, L02 cells, mouse liver tissue
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• CoIP: See 1 publications below

Product Information

14118-1-AP targets FLAD1 in WB, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5267

  Product name: Recombinant human FLAD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 148-447 aa of BC011378

  Sequence: LVSVRNVYLFPGIPELLRRVLEGMKGLFQNPAVQFHSKELYVAADEASIAPILAEAQAHFGRRLGLGSYPDWGSNYYQVKLTLDSEEEGPLEECLAYLTARLPQGSLVPYMPNAVEQASEAVYKLAESGSSLGKKVAGALQTIETSLAQYSLTQLCVGFNGGKDCTALLHLFHAAVQRKLPDVPNPLQILYIRSISPFPELEQFLQDTIKRYNLQMLEAEGSMKQALGELQARHPQLEAVLMGTRRTDPYSCSLCPFSPTDPGWPAFMRINPLLDWTYRDIWDFLRQLFVPYCILYDRG

• Full Name: FAD1 flavin adenine dinucleotide synthetase homolog (S. cerevisiae)
• Calculated Molecular Weight: 446 aa, 49 kDa
• Observed Molecular Weight: 50 kDa, 65-70 kDa
• GenBank Accession Number: BC011378
• Gene Symbol: FLAD1
• Gene ID (NCBI): 80308
• RRID: AB_2878017
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NFF5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FLAD1 is a protein-coding gene for flavin adenine dinucleotide synthetase (FADS), a key enzyme in the FAD biosynthesis process which contains an N-terminal molybdopterin -binding (MPTb) domain and a C-terminal domain (FADS domain) (PMID: 32714079). Alternative splicing of the human FLAD1 gene generates different isoforms of the enzyme FAD synthase. ~60 and ~50 kDa bands correspond to the expected mitochondrial FADS1 and cytosolic FADS2 proteins, respectively (PMID: 29316637).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,CoIP	Anal Chem; Ionic Liquid-Based Extraction System for In-Depth Analysis of Membrane Protein Complexes.; Authors - Hongwei Chu
mouse	WB	Ecotoxicol Environ Saf; Di (2-ethylhexyl) phthalate reduces sperm motility by decreasing sperm tail energy supply; Authors - Xiao-Lu Li