FKBP1A Polyclonal antibody

• 

  WB analysis using 10273-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 10273-1-AP (FKBP1A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 10273-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10273-1-AP (FKBP1A antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 10273-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 10273-1-AP (FKBP1A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon using 10273-1-AP

  Immunohistochemical analysis of paraffin-embedded normal colon slide using 10273-1-AP (FKBP1A antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 10273-1-AP

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 10273-1-AP (FKBP1A antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary cancer using 10273-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 10273-1-AP (FKBP1A antibody) at dilution of 1:600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

FKBP1A Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10273-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, ELISA

Synonyms

12 kDa FK506-binding protein, Calstabin-1, FK506-binding protein 1A, FKBP 1A, FKBP1

---

Tested Applications

• Positive WB detected in: mouse brain tissue, Jurkat cells, rat brain tissue
• Positive IHC detected in: human normal colon, human colon tissue, human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 7 publications below
• IHC: See 1 publications below

Product Information

10273-1-AP targets FKBP1A in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0406

  Product name: Recombinant human FKBP1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 6-108 aa of BC001925

  Sequence: ETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE

• Full Name: FK506 binding protein 1A, 12kDa
• Calculated Molecular Weight: 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC001925
• Gene Symbol: FKBP1A
• Gene ID (NCBI): 2280
• RRID: AB_2231588
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P62942
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FKBP1A(FK506-binding protein 1A) is also named as FKBP1, FKBP12 and belongs to the FKBP-type PPIase family.It keeps in an inactive conformation TGFBR1, the TGF-beta type I serine/threonine kinase receptor, preventing TGF-beta receptor activation in absence of ligand and catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Rep; Sequencing of captive target transcripts identifies the network of regulated genes and functions of primate-specific miR-522.; Authors - Shen Mynn Tan
pig	WB	Food Chem; TMT-based quantitative proteomic analysis of porcine muscle associated with postmortem meat quality.; Authors - Xinhua Hou
mouse	WB,IHC	Cell Biol Toxicol; Andrographolide ameliorates sepsis-induced acute liver injury by attenuating endoplasmic reticulum stress through the FKBP1A-mediated NOTCH1/AK2 pathway; Authors - Jiaqi He
human	WB	Oncotarget; TGFBR-IDH1-Cav1 axis promotes TGF-β signalling in cancer-associated fibroblast.; Authors - Xiaodan Hou
human	WB	Mol Pharmacol; FK506 Binding Protein 12 Modulates μ Opioid Receptor Phosphorylation and PKC{epsilon}-dependent Signaling by its Direct Interaction with the Receptor.; Authors - Qiu Yu Y ; KD Validated
mouse	WB	Development; PFN4 is required for manchette development and acrosome biogenesis during mouse spermiogenesis; Authors - Naila Umer