Fibrinogen Beta Chain Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Fibrinogen Beta Chain Polyclonal antibody (16747-1-AP)

• Featured Product
• KD/KO Validated

Fibrinogen Beta Chain Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 16747-1-AP Copied!

Publications (23)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF-P, ELISA

Synonyms

FGB, HEL-S-78p

• 

  WB analysis of mouse heart using 16747-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 16747-1-AP (Fibrinogen beta chain antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse kidney using 16747-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 16747-1-AP (Fibrinogen beta chain antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 16747-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 16747-1-AP (Fibrinogen beta chain antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 16747-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 16747-1-AP (Fibrinogen beta chain antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 16747-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 16747-1-AP (Fibrinogen beta chain antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 16747-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 16747-1-AP (Fibrinogen beta chain antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse heart using 16747-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse heart tissue using Fibrinogen Beta Chain antibody (16747-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Fibrinogen Beta Chain in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse heart tissue, mouse kidney tissue, mouse brain tissue, mouse liver tissue
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse heart tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16747-1-AP targets Fibrinogen Beta Chain in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, plasmodium falciparum
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10169

  Product name: Recombinant human FGB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 142-491 aa of BC107766

  Sequence: SSSFQYMYLLKDLWQKRQKQVKDNENVVNEYSSELEKHQLYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEITRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFFPQQ

• Full Name: fibrinogen beta chain
• Calculated Molecular Weight: 491 aa, 56 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC107766
• Gene Symbol: Fibrinogen Beta Chain
• Gene ID (NCBI): 2244
• RRID: AB_11042764
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P02675
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Fibrinogen is a soluble plasma glycoprotein synthesized in the liver. It is composed of two sets of three structurally different subunits: alpha (FGA), beta (FGB), gamma (FGG). Fibrinogen is converted by thrombin into fibrin during blood coagulation. Fibrinogen and fibrin play overlapping roles in blood clotting, fibrinolysis, cellular and matrix interactions, the inflammatory response, wound healing, and neoplasia (PMID: 16102057). FGB is the beta chain of fibrinogen. During conversion of fibrinogen to fibrin, fibrinopeptide B is cleaved from FGB by thrombin. Mutations in the gene of FGB lead to several disorders, including afibrinogenemia, dysfibrinogenemia, hypodysfibrinogenemia and thrombotic tendency.

Publications

What published studies show

Anti-Fibrinogen Beta Chain (FGB) antibody (Cat# 16747-1-AP) has accumulated 23 citations across 21 journals, including Blood, Nature Communications, Journal of Thrombosis and Haemostasis, Molecular Oncology, and Frontiers in Neuroscience. Associated research fields encompass hematology/coagulation, hepatology, nephrology, neuroscience, oncology, cardiology, reproductive biology, and infectious disease. Applications span Western blot, immunohistochemistry, and immunofluorescence in human, mouse, rat, and other species.

Automatically generated from the 23 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat,human	IHC,IF	Blood; Fibrinogen β-derived Bβ(15-42) peptide protects against kidney ischemia/reperfusion injury.; Authors - Krishnamoorthy Aparna A
human	WB	Blood; Tissue transglutaminase drives fibrin β-chain cross-linking: a novel fibrin modification observed in patients with trauma.; Authors - Nana Kwame Kwabi Boateng
mouse	WB	Nat Commun; Timed secreted proteomes reveal regulation of hepatokines by the liver circadian clock.; Authors - Christopher Litwin
mouse	WB,IF	Nat Commun; Regulation of hepatic inclusions and fibrinogen biogenesis by SEL1L-HRD1 ERAD; Authors - Zhenfeng Song
mouse	IHC	Carbohydr Polym; Oral efficacy of structurally defined chondroitin sulfate Co-administered with SNAC in Parkinson's disease.; Authors - Ying Guo
mouse	IF	Cell Mol Biol Lett; Growth differentiation factor 11 attenuates sepsis-associated acute kidney injury by reducing inflammation and coagulation via PGC-1α/Nrf2 activation.; Authors - Hong-Wei Wang