FCGR2A / CD32a Monoclonal antibody, PBS Only

• 

  WB analysis using 66529-1-Ig (same clone as 66529-1-PBS)

  Untreated and PNGase F-treated lysates of THP-1 cells and Mo7e cells were subjected to SDS PAGE followed by western blot with 66529-1-Ig (FCGR2A / CD32a antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66529-1-PBS in a different storage buffer formulation.

• 

  WB analysis of U-937 using 66529-1-Ig (same clone as 66529-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66529-1-Ig (FCGR2A / CD32a antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66529-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Raji using 66529-1-Ig (same clone as 66529-1-PBS)

  Raji cells were subjected to SDS PAGE followed by western blot with 66529-1-Ig (FCGR2A / CD32a antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66529-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66529-1-Ig (same clone as 66529-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66529-1-Ig (FCGR2A / CD32a antibody) at dilution of 1:5000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66529-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66529-1-Ig (same clone as 66529-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66529-1-Ig (FCGR2A / CD32a antibody) at dilution of 1:5000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66529-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 66529-1-Ig (same clone as 66529-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66529-1-Ig (FCGR2A / CD32a antibody) at dilution of 1:5000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66529-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 66529-1-Ig (same clone as 66529-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66529-1-Ig (FCGR2A / CD32a antibody) at dilution of 1:5000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66529-1-PBS in a different storage buffer formulation.

• 

  IF Staining of THP-1 using 66529-1-Ig (same clone as 66529-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed THP-1 cells using FCGR2A / CD32a antibody (66529-1-Ig, Clone: 1D3F1 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66529-1-PBS in a different storage buffer formulation.

FCGR2A / CD32a Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66529-1-PBS

Clone No.1D3F1

Host / Isotype

Mouse / IgG2b

Reactivity

Human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

CD32, CD32A, CDw32, Fc gamma RII a, Fc gamma RIIa, FCG2, FcGR, FCGR2, FCGR2A, FCGR2A1, FcRII a, IGFR2, IgG Fc receptor II a

---

Product Information

66529-1-PBS targets FCGR2A / CD32a in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25878

  Product name: Recombinant human FCGR2A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 44-215 aa of BC020823

  Sequence: LEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPM

• Full Name: Fc fragment of IgG, low affinity IIa, receptor (CD32)
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC020823
• Gene Symbol: CD32a
• Gene ID (NCBI): 2212
• RRID: AB_2881892
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P12318
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

IgG Fc receptors (FcγRs) play important roles in immune responses. Low affinity IgG Fc receptor Fc gamma RIIa (FCGR2A, CD32a) is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes.