Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

Fas/CD95 Polyclonal antibody

Fas/CD95 Polyclonal Antibody for WB, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human and More (4)

Applications

WB, IHC, IF, IP, CoIP, CHIP, ELISA

FAS, ALPS1A, APO-1, Apo-1 antigen, Apoptosis-mediating surface antigen FAS

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for Fas/CD95 in ?

Tested Applications

Positive WB detected inHT-1080 cells, HepG2 cells, HT-29 cells, Jurkat cells, HeLa cells
Positive IP detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13098-1-AP targets Fas/CD95 in WB, IHC, IF, IP, CoIP, CHIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, monkey, hamster, goat, sheep
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3718

Product name: Recombinant human FAS protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 156-335 aa of BC012479

Sequence: ECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV

Predict reactive species
Full Name Fas (TNF receptor superfamily, member 6)
Calculated Molecular Weight 35-38 kDa
Observed Molecular Weight 38-45 kDa
GenBank Accession NumberBC012479
Gene Symbol Fas/CD95
Gene ID (NCBI) 355
RRIDAB_2278042
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP25445
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Fas (CD95/APO-1) is a transmembrane glycoprotein belonging to the tumor necrosis factor (TNF) receptor superfamily. It can mediate apoptosis by ligation with an agonistic anti-Fas antibody or Fas ligand. Stimulation of Fas results in the aggregation of its intracellular death domains, leading to the formation of the death-inducing signaling complex (DISC). FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. The molecular mass of native Fas is 38 kDa, the high molecular weight form (40-55 kDa) of Fas is due to glycosylation.

Protocols

Product Specific Protocols
IP protocol for Fas/CD95 antibody 13098-1-APDownload protocol
WB protocol for Fas/CD95 antibody 13098-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Mouse anti-FAS antibody (Cat# 13098-1-AP) has 153 citations published in journals including Cell, Nature Communications, Cell Research, Gut, Advanced Science, Cell Death & Disease, Cancer Letters, Oncogene, and Biomaterials. Research fields span oncology (colorectal, breast, lung, liver, gastric, and other cancers), apoptosis and cell death signaling, lipid metabolism and NAFLD, inflammation, immunology, neurology, reproductive biology, and pharmacology of natural compounds.

SpeciesApplicationTitle
humanIF

Cell

Neutrophil elastase selectively kills cancer cells and attenuates tumorigenesis.

Authors - Chang Cui
humanWB

Cell Res

DNA damage triggers tubular endoplasmic reticulum extension to promote apoptosis by facilitating ER-mitochondria signaling.

Authors - Pengli Zheng
humanWB

Gut

Nuclear Pirin promotes HCC by acting as a key inflammation-facilitating factor

Authors - Huanhuan Ma
humanWB,IP,IF

Nat Commun

A neutrophil mimicking metal-porphyrin-based nanodevice loaded with porcine pancreatic elastase for cancer therapy

Authors - Tingting Cui
humanWB,IF

Exp Mol Med

Targeting the IL-1β/IL-1Ra pathways for the aggregation of human islet amyloid polypeptide in an ex vivo organ culture system of the intervertebral disc.

Authors - Xinghuo Wu
WB

Metabolism

AGEs exacerbates coronary microvascular dysfunction in NoCAD by activating endoplasmic reticulum stress- mediated PERK signaling pathway.

Authors - Zhongwei Liu

Reviews

    4.0 out of 5
Add a review

2 verified customer reviews

What customers say

Both reviewers rated this antibody 4 out of 5 stars. One user found it effective for Western blot on ovarian cancer and melanoma cell lines at 1:1000 dilution, noting some non-specific binding but that the target band was still easily identifiable. The other user confirmed good performance in both Western blot and immunofluorescence on human and mouse cell lines at the same 1:1000 dilution. Overall, users report reliable target detection with minor background issues.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Macarena Lucia (Verified Customer) (11-16-2021)

Some unspecific binding but the target is very easy to identify.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: ovarian ca cell lines / melanoma cell lines

Kishor (Verified Customer) (06-23-2019)

This antibody works good at 1:1000 dilution in WB for mouse and human cells.

  • Applications: Western Blot, Immunofluorescence,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Human and mouse cell lines
Fas/CD95 Antibody Western Blot,Immunofluorescence, validation (1:1000 dilution) in Human and mouse cell lines (Cat no:13098-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...