ErbB3/HER3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ErbB3/HER3 Polyclonal antibody, PBS Only (30452-1-PBS)

ErbB3/HER3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 30452-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

ERBB3, c erbB 3, c erbB3, EC:2.7.10.1, ErbB 3

• 

  WB analysis using 30452-1-AP (same clone as 30452-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30452-1-AP (ERBB3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30452-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 30452-1-AP (same clone as 30452-1-PBS)

  WB result of ErbB3/HER3 antibody (30452-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-ErbB3/HER3 transfected MCF-7 cells. This data was developed using the same antibody clone with 30452-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

30452-1-PBS targets ErbB3/HER3 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30713

  Product name: Recombinant human ERBB3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1037-1342 aa of BC082992

  Sequence: TLNRPRGSQSLLSPSSGYMPMNQGNLGESCQESAVSGSSERCPRPVSLHPMPRGCLASESSEGHVTGSEAELQEKVSMCRSRSRSRSPRPRGDSAYHSQRHSLLTPVTPLSPPGLEEEDVNGYVMPDTHLKGTPSSREGTLSSVGLSSVLGTEEEDEDEEYEYMNRRRRHSPPHPPRPSSLEELGYEYMDVGSDLSASLGSTQSCPLHPVPIMPTAGTTPDEDYEYMNRQRDGGGPGGDYAAMGACPASEQGYEEMRAFQGPGHQAPHVHYARLKTLRSLEATDSAFDNPDYWHSRLFPKANAQRT

• Full Name: v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian)
• Observed Molecular Weight: 200 kDa
• GenBank Accession Number: BC082992
• Gene Symbol: ERBB3
• Gene ID (NCBI): 2065
• RRID: AB_3086320
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P21860
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

V-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (ErbB-3, HER3) is a member of the EGF receptor tyrosine kinase family including EGFR (HER1), Neu (ErbB-2, HER2), ErbB-3 (HER3), and ErbB-4 (HER4) that are frequently overexpressed in a variety of carcinomas. These family members form either homodimers or heterodimers upon ligand binding to mediate cell growth. ErbB-3 binds and is activated by neuregulins and NTAK. It forms a heterodimer with each of the other ErbB receptors. ErbB-3 is predominantly expressed in epithelial tissues and the brain and is overexpressed in a subset of human mammary tumors.