EIF3B Monoclonal antibody, PBS Only

EIF3B Monoclonal Antibody for WB, Indirect ELISA
Cat No. 68202-1-PBS
Clone No.1G12G12

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat

Applications

WB, Indirect ELISA

eIF 3 eta, EIF3 ETA, EIF3 P110, EIF3 P116, EIF3B, EIF3S9, hPrt1, PRT1, Prt1 homolog

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68202-1-PBS targets EIF3B in WB, Indirect ELISA applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag31427

Product name: Recombinant human EIF3B protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 381-562 aa of BC001173

Sequence: FSPCERYLVTFSPLMDTQDDPQAIIIWDILTGHKKRGFHCESSAHWPIFKWSHDGKFFARMTLDTLSIYETPSMGLLDKKSLKISGIKDFSWSPGGNIIAFWVPEDKDIPARVTLMQLPTRQEIRVRNLFNVVDCKLHWQKNGDYLCVKVDRTPKGTQGVVTNFEIFRMREKQVPVDVVEMK

Predict reactive species
Full Name eukaryotic translation initiation factor 3, subunit B
Calculated Molecular Weight 93 kDa
Observed Molecular Weight 115 kDa
GenBank Accession NumberBC001173
Gene Symbol EIF3B
Gene ID (NCBI) 8662
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP55884
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

EIF3B, also named Eukaryotic translation initiation factor 3 subunit B, is an 814 amino acid protein, which contains 1 RRM (RNA recognition motif) domain and 8 WD repeats and belongs to the eIF-3 subunit B family. EIF3B as an RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation, and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression. The calculated molecular weight of EIF3B is 93 kDa, but the phosphorylated EIF3B protein is about 115 kDa.

Loading...
||
New chat Able
正在加载,请稍候...