PHD1 Polyclonal antibody

• 

  WB analysis of mouse testis using 12984-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 12984-1-AP (PHD1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 12984-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 12984-1-AP (PHD1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human spleen using 12984-1-AP

  human spleen tissue were subjected to SDS PAGE followed by western blot with 12984-1-AP (PHD1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-3 using 12984-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 12984-1-AP (PHD1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 12984-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 12984-1-AP (PHD1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse heart using 12984-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 12984-1-AP (PHD1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

PHD1 Polyclonal Antibody for WB, ELISA

Cat No. 12984-1-AP

Publications(11)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

EGLN2, EC:1.14.11.-, EC:1.14.11.29, EIT6, EIT-6

---

Tested Applications

• Positive WB detected in: mouse testis tissue, HEK-293 cells, HeLa cells, human spleen tissue, mouse heart tissue, PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 9 publications below
• IHC: See 1 publications below
• IF: See 2 publications below

Product Information

12984-1-AP targets PHD1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3616

  Product name: Recombinant human EGLN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 190-407 aa of BC036051

  Sequence: GICVKDSFLGAALGGRVLAEVEALKRGGRLRDGQLVSQRAIPPRSIRGDQIAWVEGHEPGCRSIGALMAHVDAVIRHCAGRLGSYVINGRTKAMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIFWSDRRNPHEVKPAYATRYAITVWYFDAKERAAAKDKYQLASGQKGVQVPVSQPPTPT

• Full Name: egl nine homolog 2 (C. elegans)
• Calculated Molecular Weight: 407 aa, 44 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC036051
• Gene Symbol: PHD1
• Gene ID (NCBI): 112398
• RRID: AB_2096849
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96KS0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EGLN2, also named as PHD1, EIT6 and HPH-3, catalyzes the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. It hydroxylates HIF-1 alpha at 'Pro-402' and 'Pro-564', and HIF-2 alpha. EGLN2 functions as a cellular oxygen sensor and, under normoxic conditions, targets HIF through the hydroxylation for proteasomal degradation via the von Hippel-Lindau ubiquitination complex. It may play a role in cell growth regulation.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell Res; Hypoxia induces mitochondrial protein lactylation to limit oxidative phosphorylation; Authors - Yunzi Mao
human	WB	Respir Res; Short isoform thymic stromal lymphopoietin reduces inflammation and aerobic glycolysis of asthmatic airway epithelium by antagonizing long isoform thymic stromal lymphopoietin.; Authors - Changhui Yu
mouse	WB,IHC	Am J Pathol; Genetic Loss of HIF-Prolyl-Hydroxylase 1, but Not Pharmacological Inhibition, Mitigates Hepatic Fibrosis; Authors - Christopher Tuffs
rat	IF	J Cell Mol Med; LncRNA MIAT enhances cerebral ischaemia/reperfusion injury in rat model via interacting with EGLN2 and reduces its ubiquitin-mediated degradation.; Authors - Suping Li
human	WB	Asian J Androl; CHD1 deletion stabilizes HIF1α to promote angiogenesis and glycolysis in prostate cancer; Authors - Yu-Zhao Wang
human	IF	Leuk Lymphoma; Localization of collagen modifying enzymes on fibroblastic reticular cells and follicular dendritic cells in non-neoplastic and neoplastic lymphoid tissues.; Authors - Rintaro Ohe