Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

EEA1 Polyclonal antibody

EEA1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 28347-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse, Rat and More (4)

Applications

WB, IHC, IF/ICC, ELISA

Cell and organelle markers, early endosome antigen 1, EEA1, Endosome Marker, MST105, MSTP105, ZFYVE2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 647
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, HepG2 cells, HeLa cells, Jurkat cells, NIH/3T3 cells, C6 cells
Positive IHC detected inhuman breast cancer tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

28347-1-AP targets EEA1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat samples.

Tested Reactivity Human, Mouse, Rat
Cited Reactivityhuman, mouse, pig, monkey
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag28814

Product name: Recombinant human EEA1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1151-1350 aa of NM_003566

Sequence: KLESIKEITNLKDAKQLLIQQKLELQGKADSLKAAVEQEKRNQQILKDQVKKEEEELKKEFIEKEAKLHSEIKEKEVGMKKHEENEAKLTMQITALNENLGTVKKEWQSSQRRVSELEKQTDDLRGEIAVLEATVQNNQDERRALLERCLKGEGEIEKLQTKVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWA

Predict reactive species
Full Name early endosome antigen 1
Calculated Molecular Weight 162 kDa
Observed Molecular Weight 170 kDa
GenBank Accession NumberNM_003566
Gene Symbol EEA1
Gene ID (NCBI) 8411
RRIDAB_2881117
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ15075
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Early endosome antigen 1 (EEA1) is a marker of early endosomes and has an important role in endosomal trafficking. EEA1 contains coiled-coil regions and an FYVE-type zinc finger which interacts with phosphatidylinositol-3-phosphate. EEA1 functions as a Rab5 effector, mediates endosome docking and, together with SNAREs, leads to membrane fusion.

Protocols

Product Specific Protocols
IF protocol for EEA1 antibody 28347-1-APDownload protocol
IHC protocol for EEA1 antibody 28347-1-APDownload protocol
WB protocol for EEA1 antibody 28347-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle

Cell Metab

Oral GLP-1 receptor agonist promotes astrocyte-neuron lactate and lipid transfer with neuroprotective effects.

Authors - Yixuan Du
mouseIF

Adv Mater

Noninvasive Optogenetics Realized by iPSC-Derived Tentacled Carrier in Alzheimer's Disease Treatment

Authors - Yuewen Zhai
mouseWB

Nat Aging

DNA damage in macrophages drives immune autoreactivity via nuclear antigen presentation.

Authors - George Niotis

Cell Mol Immunol

Mycobacterium tuberculosis MEM39 (Rv1977) hijacks host aldolase A (ALDOA) to subvert immunometabolism to facilitate bacterial intracellular survival.

Authors - Yuanyuan Zhou
mouseIF

Bone Res

Pak4-mediated crosstalk between necroptotic macrophages and tendon stem/progenitor cells contributes to traumatic heterotopic ossification formation.

Authors - Ziyang Sun
mouseIF

Nat Commun

Sortilin-mediated translocation of mitochondrial ACSL1 impairs adipocyte thermogenesis and energy expenditure in male mice

Authors - Min Yang

Reviews

    5.0 out of 5
Add a review

2 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


K. (Verified Customer) (10-26-2023)

This antibody worked nicely for WB at 1:1000 and immunoflurecence at 1:200 dilution.

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Human Liver cells

Sarah (Verified Customer) (02-09-2023)

Worked well for 1hr IF incubation at RT

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: hct116
Loading...
||
New chat

Able

正在加载,请稍候...