DYNLT1 Polyclonal antibody

• 

  WB analysis of human brain using 11954-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 11954-1-AP (DYNLT1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human heart using 11954-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 11954-1-AP (DYNLT1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Sp2/0 using 11954-1-AP

  Sp2/0 cells were subjected to SDS PAGE followed by western blot with 11954-1-AP (DYNLT1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse skeletal muscle using 11954-1-AP

  IP result of anti-DYNLT1 (IP:11954-1-AP, 4ug; Detection:11954-1-AP 1:300) with mouse skeletal muscle tissue lysate 3600ug.

• 

  IHC staining of human pancreas using 11954-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas using 11954-1-AP (DYNLT1 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human pancreas using 11954-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas using 11954-1-AP (DYNLT1 antibody) at dilution of 1:50 (under 10x lens).

• 

  IF Staining of mouse testis using 11954-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using DYNLT1 antibody (11954-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of mouse testis using 11954-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using DYNLT1 antibody (11954-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of SH-SY5Y using 11954-1-AP

  Immunofluorescent analysis of (4% PFA) fixed SH-SY5Y cells using DYNLT1 antibody (11954-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

DYNLT1 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IP, ELISA

Cat No. 11954-1-AP

Publications(11)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, IP, ELISA

Synonyms

TCTEL1, T-complex testis-specific protein 1 homolog, Protein CW-1, Protein CW 1, Dynein light chain Tctex-type 1

---

Tested Applications

• Positive WB detected in: human brain tissue, human heart tissue, Sp2/0 cells
• Positive IP detected in: mouse skeletal muscle tissue
• Positive IHC detected in: human pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse testis tissue
• Positive IF/ICC detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:300-1:600
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 7 publications below
• IHC: See 3 publications below
• IF: See 4 publications below

Product Information

11954-1-AP targets DYNLT1 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2557

  Product name: Recombinant human DYNLT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-113 aa of BC029412

  Sequence: MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI

• Full Name: dynein, light chain, Tctex-type 1
• Calculated Molecular Weight: 113 aa, 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC029412
• Gene Symbol: DYNLT1
• Gene ID (NCBI): 6993
• RRID: AB_2230661
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P63172
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DYNLT (or Tctex-1) was originally described as a light chain component of the dynein motor complex. Tctex-1 also has several dynein-independent functions, including roles in G protein signaling activation and neuronal growth. Tctex-1 is selectively enriched in proliferating neural progenitors of both embryonic and adult brains. Genetic knockdown of Tctex-1 in radial precursors promoted neurogenesis, indicating its implication in regulation of cortical neurogenesis. (Pubmed: 19448628)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IF	Nanomicro Lett; Molecular Mechanisms of Intracellular Delivery of Nanoparticles Monitored by an Enzyme-Induced Proximity Labeling; Authors - Junji Ren
mouse	WB,IHC,IF	Nat Neurosci; Lfc and Tctex-1 regulate the genesis of neurons from cortical precursor cells.; Authors - Gauthier-Fisher Andrée A ; KD Validated
mouse	WB	Cell Res; Dlic1 deficiency impairs ciliogenesis of photoreceptors by destabilizing dynein.; Authors - Kong Shanshan S
human	WB	J Cell Biol; Ndel1 suppresses ciliogenesis in proliferating cells by regulating the trichoplein-Aurora A pathway.; Authors - Hironori Inaba ; KD Validated
human	IHC	Cancers (Basel); Dynein Light Chain Protein Tctex1: A Novel Prognostic Marker and Molecular Mediator in Glioblastoma.; Authors - Claudia Alexandra Dumitru
	WB	Biochem Pharmacol; Cannabinoid receptor-2 expression modulates Gβ1γ2 protein interaction with the activator of G protein signalling 2/dynein light chain protein Tctex-1.; Authors - Marina Nagler