DYNC1I2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• DYNC1I2 Polyclonal antibody (12219-1-AP)

• Featured Product
• KD/KO Validated

DYNC1I2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 12219-1-AP Copied!

Publications (7)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

DH IC 2, DH IC-2, DNCI2, DNCIC2, IC2

• 

  WB analysis of Jurkat using 12219-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 12219-1-AP (DYNC1I2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 12219-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 12219-1-AP (DYNC1I2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 12219-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 12219-1-AP (DYNC1I2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A375 using 12219-1-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 12219-1-AP (DYNC1I2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse testis using 12219-1-AP

  IP result of anti-DYNC1I2 (IP:12219-1-AP, 4ug; Detection:12219-1-AP 1:500) with mouse testis tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 12219-1-AP

  IP result of anti-DYNC1I2 (IP:12219-1-AP, 4ug; Detection:12219-1-AP 1:500) with HeLa cells lysate 2080 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse stomach using 12219-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 12219-1-AP (DYNC1I2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse stomach using 12219-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 12219-1-AP (DYNC1I2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse cerebellum using 12219-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 12219-1-AP (DYNC1I2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse cerebellum using 12219-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 12219-1-AP (DYNC1I2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat cerebellum using 12219-1-AP

  Immunohistochemical analysis of paraffin-embedded rat cerebellum tissue slide using 12219-1-AP (DYNC1I2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat cerebellum using 12219-1-AP

  Immunohistochemical analysis of paraffin-embedded rat cerebellum tissue slide using 12219-1-AP (DYNC1I2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A375 using 12219-1-AP

  Immunofluorescent analysis of A375 cells using 12219-1-AP (DYNC1I2 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for DYNC1I2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells, A375 cells, human brain tissue, mouse testis tissue
• Positive IP detected in: mouse testis tissue, HeLa cells
• Positive IHC detected in: mouse stomach tissue, mouse cerebellum tissue, rat cerebellum tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A375 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12219-1-AP targets DYNC1I2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2873

  Product name: Recombinant human DYNC1I2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 304-612 aa of BC015038

  Sequence: HCQSAVMSATFAKFHPNLVVGGTYSGQIVLWDNRSNKRTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLISISTDGKICSWSLDMLSHPQDSMELVHKQSKAVAVTSMSFPVGDVNNFVVGSEEGSVYTACRHGSKAGISEMFEGHQGPITGIHCHAAVGAVDFSHLFVTSSFDWTVKLWTTKNNKPLYSFEDNADYVYDVMWSPTHPALFACVDGMGRLDLWNLNNDTEVPTASISVEGNPALNRVRWTHSGREIAVGDSEGQIVIYDVGEQIAVPRNDEWARFGRTLAEINANRADAEEEAATRIPA

• Full Name: dynein, cytoplasmic 1, intermediate chain 2
• Calculated Molecular Weight: 612 aa, 68 kDa
• Observed Molecular Weight: 68-72 kDa
• GenBank Accession Number: BC015038
• Gene Symbol: DYNC1I2
• Gene ID (NCBI): 1781
• RRID: AB_2093630
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13409
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The DYNC1I2 Polyclonal antibody (Cat# 12219-1-AP) has 7 citations published in Nature Communications, Cell Reports, Journal of Cell Biology, Journal of Biological Chemistry, Development, PLoS One, and bioRxiv. Research fields include axonal and mitochondrial transport, ciliogenesis, neuroprotection against viral infection, diabetic peripheral neuropathy, spermatid elongation, and targeted protein degradation.

Automatically generated from the 7 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; DISC1 Protects Against Zika Virus Infection and Long-Term Neurological Damage Through AMPK-mTOR-Mediated Autophagy; Authors - Shengze Zhang
human	WB,IP	Cell Rep; COP9 signalosome and PRMT5 methylosome complexes are essential regulators of Lis1-dynein-based transport.; Authors - Devanshi Gupta
human	WB	J Cell Biol; Ndel1 suppresses ciliogenesis in proliferating cells by regulating the trichoplein-Aurora A pathway.; Authors - Hironori Inaba ; KD Validated
rat	WB,IHC,IF	J Biol Chem; Bisphenol-A impairs hippocampal neurogenesis by disrupting Kinesin-1-dependent mitochondrial trafficking.; Authors - Phoolmala
human	IP	Development; SPEF2 functions in microtubule-mediated transport in elongating spermatids.; Authors - Mari S Lehti
rat,mouse	WB,IF	PLoS One; Effect of ALA on preventing diabetic peripheral neuropathy in rats through mitochondrial axonal transport.; Authors - Jiaxin Tian