DTX3L Polyclonal antibody

• Home
• Products
• Primary Antibodies
• DTX3L Polyclonal antibody (11963-1-AP)

• KD/KO Validated

DTX3L Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11963-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, ELISA

Synonyms

BBAP, B-lymphoma- and BAL-associated protein, deltex 3 like (Drosophila), E3 ubiquitin-protein ligase DTX3L, EC:2.3.2.27

• 

  WB analysis of MCF-7 using 11963-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 11963-1-AP (DTX3L antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of U2OS using 11963-1-AP

  WB result of DTX3L antibody (11963-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-DTX3L transfected U2OS cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary cancer using 11963-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 11963-1-AP (DTX3L antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 11963-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 11963-1-AP (DTX3L antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse lung using 11963-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 11963-1-AP (DTX3L antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse ovary using 11963-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 11963-1-AP (DTX3L antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat kidney using 11963-1-AP

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 11963-1-AP (DTX3L antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat lung using 11963-1-AP

  Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 11963-1-AP (DTX3L antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat ovary using 11963-1-AP

  Immunohistochemical analysis of paraffin-embedded rat ovary tissue slide using 11963-1-AP (DTX3L antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse ovary using 11963-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 11963-1-AP (DTX3L antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat ovary using 11963-1-AP

  Immunohistochemical analysis of paraffin-embedded rat ovary tissue slide using 11963-1-AP (DTX3L antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary cancer using 11963-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 11963-1-AP (DTX3L antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: MCF-7 cells, U2OS cells
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11963-1-AP targets DTX3L in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, goat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2568

  Product name: Recombinant human DTX3L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 430-741 aa of BC060509

  Sequence: SVHAYASFIDAFQHASCQLMREVLLLKSLGKERKHLHQTKFADDFRKRHPNVHFVLNQESMTLTGLPNHLAKAKQYVLKGGGMSSLAGKKLKEGHETPMDIDSDDSKAASPPLKGSVSSEASELDKKEKGICVICMDTISNKKVLPKCKHEFCAPCINKAMSYKPICPTCQTSYGIQKGNQPEGSMVFTVSRDSLPGYESFGTIVITYSMKAGIQTEEHPNPGKRYPGIQRTAYLPDNKEGRKVLKLLYRAFDQKLIFTVGYSRVLGVSDVITWNDIHHKTSRFGGPEMYGYPDPSYLKRVKEELKAKGIE

• Full Name: deltex 3-like (Drosophila)
• Calculated Molecular Weight: 740 aa, 84 kDa
• Observed Molecular Weight: 84 kDa
• GenBank Accession Number: BC060509
• Gene Symbol: DTX3L
• Gene ID (NCBI): 151636
• RRID: AB_874119
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TDB6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Int J Biol Macromol; E3 ubiquitin ligase DTX3L promotes breast cancer progression by enhancing PKCα ubiquitination and inhibiting the p38 MAPK signaling pathway.; Authors - Xiaoxiao Zhang
human	WB	Cancer Cell Int; Circular RNA circEYA3 promotes the radiation resistance of hepatocellular carcinoma via the IGF2BP2/DTX3L axis; Authors - Pan Hu
goat	IHC	Biomolecules; Differential MicroRNA Expression Involved in Endometrial Receptivity of Goats.; Authors - Xupeng Zang
human	WB	Sci Rep; DTX3L promotes ovarian cancer progression and cisplatin resistance by activating JAK1/STAT1/OAS3 pathway.; Authors - Fangfang Lu ; KD Validated
human	WB,IHC	Sci Rep; Pan-cancer analysis of DTX3L as a potential prognostic and immunological biomarker.; Authors - Yunfeng Zhang ; KD Validated
human	WB	Cancer Sci; Ubiquitination of NOTCH2 by DTX3 suppresses the proliferation and migration of human esophageal carcinoma.; Authors - Xin-Yu Ding