DNMT1 Monoclonal antibody

• 

  WB analysis using 68485-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68485-1-Ig (DNMT1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

DNMT1 Monoclonal Antibody for WB, ELISA

Cat No. 68485-1-Ig

Clone No.2G5C5

Publications(2)

Reviews (1)

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat and More (2)

Applications

WB, IF, ELISA

Synonyms

AIM, CXXC9, DNA methyltransferase HsaI, DNA MTase HsaI, DNMT, DNMT1, FLJ16293, M.HsaI, MCMT

---

Tested Applications

• Positive WB detected in: A549 cells, LNCaP cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 2 publications below

Product Information

68485-1-Ig targets DNMT1 in WB, IF, ELISA applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19116

  Product name: Recombinant human DNMT1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1288-1632 aa of BC126227

  Sequence: VSFKRSMVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAIILAAAPGEKLPLFPEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEVRNGASALEISYNGEPQSWFQRQLRGAQYQPILRDHICKDMSALVAARMRHIPLAPGSDWRDLPNIEVRLSDGTMARKLRYTHHDRKNGRSSSGALRGVCSCVEAGKACDPAARQFNTLIPWCLPHTGNRHNHWAGLYGRLEWDGFFSTTVTNPEPMGKQGRVLHPEQHRVVSVRECARSQGFPDTYRLFGNILDKHRQVGNAVPPPLAKAIGLEIKLCMLAKARESASAKIKEEEAAKD

• Full Name: DNA (cytosine-5-)-methyltransferase 1
• Calculated Molecular Weight: 1632 aa, 185 kDa
• Observed Molecular Weight: 180-200 kDa
• GenBank Accession Number: BC126227
• Gene Symbol: DNMT1
• Gene ID (NCBI): 1786
• RRID: AB_3085196
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P26358
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DNA methylation is a major epigenetic modification that regulates gene expression. DNMT1, the maintenance DNA methylation enzyme, is the primary enzyme responsible for copying methylation patterns after DNA replication. DNMT1 is required for X chromosome inactivation, imprinting, genomic methylation and proper embryonic development. Overexpression of DNMT1 has been reported in various cancers. DNMT1 exists some isoforms with MW 184 kDa and 145 kDa. (PMID: 10753866)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Adv Sci (Weinh); Paternal Obesity-Induced H3K27me3 Elevation Leads to MANF-Mediated Transgenerational Metabolic Dysfunction in Female Offspring; Authors - Yajun Shi
human	WB,IF	Gene; Exploring the importance of m5c in the diagnosis and subtype classification of COPD using the GEO database; Authors - Jianjun Wu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Hua (Verified Customer) (04-26-2024)

Works very well in WB.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: mouse liver and mouse brain

DNMT1 Antibody Western Blot validation (1:1000 dilution) in mouse liver and mouse brain (Cat no:68485-1-Ig)