Use Able AI chat for product recommendations

DNMT1 Monoclonal antibody

DNMT1 Monoclonal Antibody for WB, ELISA

Cat No. 68485-1-Ig
Clone No. 2G5C5
Publications (8)
Reviews (1)
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat and More (2)

Applications

WB, IF, ELISA

AIM, CXXC9, DNA methyltransferase HsaI, DNA MTase HsaI, DNMT, DNMT1, FLJ16293, M.HsaI, MCMT

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for DNMT1 in ?

Tested Applications

Positive WB detected inA549 cells, LNCaP cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68485-1-Ig targets DNMT1 in WB, IF, ELISA applications and shows reactivity with Human, Mouse, Rat samples.

Tested Reactivity Human, Mouse, Rat
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag19116

Product name: Recombinant human DNMT1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1288-1632 aa of BC126227

Sequence: VSFKRSMVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAIILAAAPGEKLPLFPEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEVRNGASALEISYNGEPQSWFQRQLRGAQYQPILRDHICKDMSALVAARMRHIPLAPGSDWRDLPNIEVRLSDGTMARKLRYTHHDRKNGRSSSGALRGVCSCVEAGKACDPAARQFNTLIPWCLPHTGNRHNHWAGLYGRLEWDGFFSTTVTNPEPMGKQGRVLHPEQHRVVSVRECARSQGFPDTYRLFGNILDKHRQVGNAVPPPLAKAIGLEIKLCMLAKARESASAKIKEEEAAKD

Predict reactive species
Full Name DNA (cytosine-5-)-methyltransferase 1
Calculated Molecular Weight 1632 aa, 185 kDa
Observed Molecular Weight180-200 kDa
GenBank Accession NumberBC126227
Gene Symbol DNMT1
Gene ID (NCBI) 1786
RRIDAB_3085196
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP26358
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DNA methylation is a major epigenetic modification that regulates gene expression. DNMT1, the maintenance DNA methylation enzyme, is the primary enzyme responsible for copying methylation patterns after DNA replication. DNMT1 is required for X chromosome inactivation, imprinting, genomic methylation and proper embryonic development. Overexpression of DNMT1 has been reported in various cancers. DNMT1 exists some isoforms with MW 184 kDa and 145 kDa. (PMID: 10753866)

Protocols

Product Specific Protocols
WB protocol for DNMT1 antibody 68485-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The DNMT1 Monoclonal antibody (2G5C5), catalog number 68485-1-Ig, has 8 total citations. These appear in journals including Advanced Science, Biomaterials, Brain, Cell Communication & Signaling, Investigational New Drugs, Gene, and Biochemical & Biophysical Research Communications. The research fields span epigenetics, immunotherapy for acute myeloid leukemia, brain arteriovenous malformations, intrauterine growth restriction, colorectal cancer, COPD diagnosis, acute liver injury/inflammation, and cardiac hypertrophy.

SpeciesApplicationTitle
mouseIF

Adv Sci (Weinh)

Paternal Obesity-Induced H3K27me3 Elevation Leads to MANF-Mediated Transgenerational Metabolic Dysfunction in Female Offspring

Authors - Yajun Shi
mouseWB

Biomaterials

A biomimetic arsenic-based nanozyme enhances dual epigenetic regulation to improve the efficacy of immunotherapy for acute myeloid leukaemia.

Authors - Aqian Chang
humanWB

Brain

NINJ1 hypomethylation enhances endothelial dysfunction in brain arteriovenous malformations.

Authors - Chun-Jui Chen
  • KD Validated

Cell Commun Signal

Trophoblast cells rewire the epigenetic landscape of vascular smooth muscle cells to modulate plasticity: a regulatory axis disrupted in intrauterine growth restriction.

Authors - Poulomi Sarkar
humanWB

Invest New Drugs

Crocetin suppresses colorectal cancer progression by targeting TGM2 and inhibiting the JAK2/STAT3 pathway.

Authors - Shuo Chen
humanWB,IF

Gene

Exploring the importance of m5c in the diagnosis and subtype classification of COPD using the GEO database

Authors - Jianjun Wu

Reviews

    4.0 out of 5
Add a review

1 verified customer reviews

What customers say

One customer review is available for this product. Hua Jiang (April 2024) rated it 4 out of 5 stars after using it for Western Blot on mouse liver and mouse brain tissues at a 1:1000 dilution (Lot 10039098). The reviewer noted that the antibody "works very well in WB," indicating satisfactory performance for their application.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Hua (Verified Customer) (04-26-2024)

Works very well in WB.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: mouse liver and mouse brain
DNMT1 Antibody Western Blot validation (1:1000 dilution) in mouse liver and mouse brain (Cat no:68485-1-Ig)
Loading...
||
New chat

Able™

正在加载,请稍候...