Tested Applications
Positive WB detected in | mouse brain tissue, rat brain tissue |
Positive IP detected in | mouse brain tissue |
Positive IF/ICC detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 6 publications below |
Product Information
26187-1-AP targets DRP1 (N-terminal) in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24249 Product name: Recombinant human DNM1L,DLP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 69-142 aa of BC024590 Sequence: HVSQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNL Predict reactive species |
Full Name | dynamin 1-like |
Calculated Molecular Weight | 736 aa, 82 kDa |
Observed Molecular Weight | 70-78 kDa |
GenBank Accession Number | BC024590 |
Gene Symbol | DRP1 |
Gene ID (NCBI) | 10059 |
RRID | AB_2880417 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O00429 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DNM1L(Dynamin-1-like protein) , also known as dynamin-related protein 1 (DRP1), belongs to the dynamin family of large GTPases that mediate membrane remodeling during a variety of cellular processes. DNM1L has an important role in the division of growing mitochondria and peroxisomes and also mediates outer mitochondrial membrane fission in mammalian cells. DNM1L is ubiquitously expressed with abundant expression in skeletal muscle, heart, kidney and brain.Variable isoforms of DNM1L have been reported in a tissue-specific manner due to the alternative splicing.
Protocols
Product Specific Protocols | |
---|---|
IF protocol for DRP1 (N-terminal) antibody 26187-1-AP | Download protocol |
IP protocol for DRP1 (N-terminal) antibody 26187-1-AP | Download protocol |
WB protocol for DRP1 (N-terminal) antibody 26187-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Mol Cell An Epstein-Barr virus protein interaction map reveals NLRP3 inflammasome evasion via MAVS UFMylation | ||
EMBO Mol Med High-throughput screening identifies suppressors of mitochondrial fragmentation in OPA1 fibroblasts. | ||
Inflamm Res Transcriptomic analysis reveals molecular characterization and immune landscape of PANoptosis-related genes in atherosclerosis | ||
J Immunol Aggregatin is a mitochondrial regulator of MAVS activation to drive innate immunity | ||
Biochem Biophys Res Commun DUSP1 overexpression attenuates renal tubular mitochondrial dysfunction by restoring Parkin-mediated mitophagy in diabetic nephropathy. | ||
Asian J Androl Mannose inhibits the growth of prostate cancer through a mitochondrial mechanism. |