TRP2/DCT Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TRP2/DCT Polyclonal antibody (13095-1-AP)

TRP2/DCT Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 13095-1-AP Copied!

Publications (28)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, monkey

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

DCT, DT, EC:5.3.3.12, L-dopachrome Delta-isomerase, L-dopachrome tautomerase

• 

  WB analysis of A375 using 13095-1-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 13095-1-AP (TRP2/DCT antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A431 using 13095-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 13095-1-AP (TRP2/DCT antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HL-60 using 13095-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 13095-1-AP (TRP2/DCT antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HL-60 using 13095-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 13095-1-AP (TRP2/DCT antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of COS-7 using 13095-1-AP

  COS-7 cells were subjected to SDS PAGE followed by western blot with 13095-1-AP (TRP2/DCT antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 13095-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 13095-1-AP (TRP2/DCT antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A431 using 13095-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 13095-1-AP (TRP2/DCT antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat skin using 13095-1-AP

  rat skin tissue were subjected to SDS PAGE followed by western blot with 13095-1-AP (TRP2/DCT Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HL-60 using 13095-1-AP

  IP result of anti-TRP2/DCT (IP:13095-1-AP, 4ug; Detection:13095-1-AP 1:500) with HL-60 cells lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin using 13095-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 13095-1-AP (TRP2/DCT antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin using 13095-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 13095-1-AP (TRP2/DCT antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A549 using 13095-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using TRP2/DCT antibody (13095-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TRP2/DCT in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A431 cells, A375 cells, COS-7 cells, HL-60 cells, MCF-7 cells, rat skin tissue
• Positive IP detected in: HL-60 cells
• Positive IHC detected in: human skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13095-1-AP targets TRP2/DCT in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, monkey samples.

• Tested Reactivity: human, mouse, rat, monkey
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3714

  Product name: Recombinant human DCT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC028311

  Sequence: MSPLWWGFLLSCLGCKILPGAQGQFPRVCMTVDSLVNKECCPRLGAESANVCGSQQGRGQCTEVRADTRPWSGPYILRNQDDRELWPRKFFHRTCKCTGNFAGYNCGDCKFGWTGPNCERKKPPVIRQNIHSLSPQEREQFLGALDLAKKRVHPDYVITTQHWLGLLGPNGTQPQFANCSVYDFFVWLHYYSVRDTLLGPGRPYRAIDFSHQGPAFVTWHRYHLLCLERDLQRLIGNESFALPYWNFATGRNECDVCTDQLFGAARPDDPTLISRNSRFSSWETVCDSLDDYNHLVTLCNGTYEGLLRRNQMGRNSMKLPTLKDIRDCLSLQKFDNPPFFQNSTFSFRNA

• Full Name: dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2)
• Calculated Molecular Weight: 519 aa, 59 kDa
• Observed Molecular Weight: 59 kDa
• GenBank Accession Number: BC028311
• Gene Symbol: DCT
• Gene ID (NCBI): 1638
• RRID: AB_2090576
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P40126
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DCT(L-dopachrome Delta-isomerase) is also named as TYRP2,TRP2 and belongs to the tyrosinase family.human TYRP2 protein has 83% identity and 90% similarity to the mouse sequence and has all the structural characteristics of the tyrosinase protein family, including a signal peptide, 15 conserved cysteine residues, 2 copper-binding domains, and a C-terminal membrane-spanning region(PMID:8206391).

Publications

What published studies show

The TRP2/DCT Polyclonal antibody (catalog #13095-1-AP) has 28 citations. These appear in journals including Carbohydrate Polymers, Asian Journal of Pharmaceutical Sciences, Cancer Letters, Advanced Healthcare Materials, Cell Reports, Current Biology, Journal of Investigative Dermatology, Journal of Ethnopharmacology, Scientific Reports, and Human Molecular Genetics. Research fields center on melanogenesis and melanin production, melanoma, skin pigmentation and hyperpigmentation, retinal pigment epithelium, and circadian biology, with applications mainly in Western blot, immunofluorescence, and IHC.

Automatically generated from the 28 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human, mouse	WB	Carbohydr Polym; Naturally derived polysaccharides and ganoderic acid A hydrogel with whitening potential to combat oxidative stress and melanin production caused by ultraviolet B.; Authors - Ting-Ting Ye
mouse	WB	Asian J Pharm Sci; A biomimetic antitumor nanovaccine based on biocompatible calcium pyrophosphate and tumor cell membrane antigens.; Authors - Minghui Li
human	WB	Cancer Lett; MiR-101 inhibits melanoma cell invasion and proliferation by targeting MITF and EZH2.; Authors - Luo Chonglin C
mouse	WB	Adv Healthc Mater; A Novel FGF2-Targeted Inhibitor (N-trans-feruloyloctopamine) Suppresses UVB-Induced Skin Damage and Hyperpigmentation.; Authors - Bowei Li
mouse	WB,IF	Int J Biol Macromol; Hair follicle-targeted delivery for hair recoloration using scalp-curvature-conforming microneedles based on sodium alginate and polyvinylpyrrolidone; Authors - Jingyi Hu
	IF	Mol Med; Comprehensive single-cell transcriptomic reveals different destinies of melanocytes and dynamic changes of immune microenvironment in a psychological stress-induced leukoderma and leukotrichia mouse model; Authors - Xuechen Cao