Use Able AI chat for product recommendations

DAXX Polyclonal antibody

DAXX Polyclonal Antibody for WB, IHC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, ELISA

BING2, DAP6, Death domain associated protein 6, Death domain-associated protein 6, EAP1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for DAXX in ?

Tested Applications

Positive WB detected inY79 cells, HeLa cells
Positive IHC detected inhuman stomach tissue, human testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

20489-1-AP targets DAXX in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag14519

Product name: Recombinant human DAXX protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-349 aa of BC109074

Sequence: MATANSIIVLDDDDEDEAAAQPGPSHPLPNAASPGAEAPSSSEPHGARGSSSSGGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPRTRGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVD

Predict reactive species
Full Name death-domain associated protein
Calculated Molecular Weight 740 aa, 81 kDa
Observed Molecular Weight 120 kDa, 70 kDa
GenBank Accession NumberBC109074
Gene Symbol DAXX
Gene ID (NCBI) 1616
RRIDAB_10693620
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UER7
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Death associated protein 6 (DAXX) is a ubiquitous protein implicated in various cellular processes such as apoptosis, tumorigenesis, development and transcription. It has been shown to translocate from the nucleus to the cytoplasm under conditions of stress and to activate the Jun N-terminal kinase (JNK) pathway. Somatic mutations of death associated protein (DAXX) have been found in ALT cancers, including pancreatic neuroendocrine (panNET) cancers and glioblastoma multiforme (GBM) cancers.

Protocols

Product Specific Protocols
IHC protocol for DAXX antibody 20489-1-APDownload protocol
WB protocol for DAXX antibody 20489-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The DAXX Polyclonal antibody (Cat# 20489-1-AP) has 4 total citations published in Cell Research, Science Bulletin, Nature Communications, and Journal of Biological Chemistry. The associated research fields include Huntington's disease (MAPK11/HIPK3 suppression), p53 upregulation via USP7-engaging molecular glues, DAXX as a SARS-CoV-2 restriction factor identified through CRISPR/Cas9 screening, and histone chaperone Spt6-mediated AID target determination through H3K4me3 regulation.

SpeciesApplicationTitle
MouseWB

Cell Res

Suppression of MAPK11 or HIPK3 reduces mutant Huntingtin levels in Huntington's disease models.

Authors - Meng Yu

Sci Bull (Beijing)

P53 upregulation by USP7-engaging molecular glues

Authors - Zhaoyang Li
humanIF

Nat Commun

Identification of DAXX as a restriction factor of SARS-CoV-2 through a CRISPR/Cas9 screen.

Authors - Alice Mac Kain
mouseWB

J Biol Chem

The histone chaperone Spt6 is required for activation-induced cytidine deaminase target determination through H3K4me3 regulation.

Authors - Nasim A Begum

Reviews

    4.0 out of 5
Add a review

2 verified customer reviews

What customers say

Both reviewers rated this antibody 4/5 for Western Blot at a 1/1000 dilution. One user reported strong DAXX detection but noted additional non-specific bands in HeLa cells when used as a positive control in co-IP experiments. The other user expressed satisfaction with the blot quality, stating it outperformed other antibodies they had previously used on adherent cells. Overall, the antibody delivers strong target signal with some variability in specificity depending on the cell type.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Roy (Verified Customer) (06-13-2024)

The antibody strongly detected DAXX by western-blot (was used as a positive control in co-immunoprecipitation experiments) but also provided many other bands in HeLa cells.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: HeLa

Alexandros (Verified Customer) (03-03-2023)

Very happy with the final image we have in our blots compared to other antibodies we have previously used

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: Adherent cells
Loading...
||
New chat

Able™

正在加载,请稍候...