Cyclin E1 Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 82700-7-PBS

  Biolayer interferometry (BLl) kinetic assay of 82700-7-PBS against Human Cyclin E1 was performed. The affinity constant is below 1 pM.

Cyclin E1 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 82700-7-PBS

Clone No.240136C9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

CCNE1, CCNE, Cyclin E, G1/S specific cyclin E1, G1/S-specific cyclin-E1

---

Product Information

82700-7-PBS targets Cyclin E1 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2110

  Product name: Recombinant human Cyclin E protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 111-410 aa of BC035498

  Sequence: ANREEVWKIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILAASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNIQTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSGKKQSSGPEMA

• Full Name: cyclin E1
• Calculated Molecular Weight: 410 aa, 47 kDa
• GenBank Accession Number: BC035498
• Gene Symbol: Cyclin E1
• Gene ID (NCBI): 898
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P24864
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.