Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

Cyclin B1 Polyclonal antibody

Cyclin B1 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, rat and More (6)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

CCNB1, CCNB, Cyclin B, G2/mitotic specific cyclin B1, G2/mitotic-specific cyclin-B1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for Cyclin B1 in ?

Tested Applications

Positive WB detected inHT-29 cells, HeLa cells, Jurkat cells, K-562 cells, C6 cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman skin cancer tissue, human tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells, HT-29 cells
Positive FC (Intra) detected inRamos cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

28603-1-AP targets Cyclin B1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Cited Reactivityhuman, mouse, rat, pig, canine, chicken, bovine, goat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag29426

Product name: Recombinant human CCNB1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-140 aa of BC006510

Sequence: MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEE

Predict reactive species
Full Name cyclin B1
Calculated Molecular Weight 48 kDa
Observed Molecular Weight 55-60 kDa
GenBank Accession NumberBC006510
Gene Symbol Cyclin B1
Gene ID (NCBI) 891
RRIDAB_2881179
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP14635
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cyclin B1 is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). Two alternative transcripts have been found, a constitutively expressed transcript and a cell cycle-regulated transcript, that is expressed predominantly during G2/M phase of the cell cycle. The different transcripts result from the use of alternate transcription initiation sites. The antibody is specific to CCNB1. We got a 55-60 kDa band in western blotting maybe due to phosphorylation.

Protocols

Product Specific Protocols
FC protocol for Cyclin B1 antibody 28603-1-APDownload protocol
IF protocol for Cyclin B1 antibody 28603-1-APDownload protocol
IHC protocol for Cyclin B1 antibody 28603-1-APDownload protocol
IP protocol for Cyclin B1 antibody 28603-1-APDownload protocol
WB protocol for Cyclin B1 antibody 28603-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The Cyclin B1 Polyclonal antibody (Cat# 28603-1-AP) has 112 citations published across approximately 85 journals, including Nature Cell Biology, Nature Communications, Cell Death & Disease, Cancer Letters, Advanced Science, and FASEB Journal. Research fields span oncology (liver, lung, breast, glioma, ovarian, colorectal cancers), cell cycle regulation, rheumatoid arthritis, reproductive biology (oocyte/spermatogenesis), drug discovery, and epigenetics. The antibody is primarily used in WB, IHC, and IF applications across human, mouse, rat, and other species.

SpeciesApplicationTitle
humanWB

Nat Cell Biol

O-GlcNAcylation determines the translational regulation and phase separation of YTHDF proteins

Authors - Yulin Chen
humanWB

Nat Commun

KY216-tubulin complex captures VASH2 to inhibit NSCLC metastasis.

Authors - Xiao-Yu He
mouseWB

Exp Mol Med

Genetic and pharmaceutical manipulation of H3K9 methyltransferase Suv39h1 promotes liver regeneration by unleashing HMGB2 transcription.

Authors - Yunjie Lu

Acta Pharm Sin B

Design, synthesis, and antitumor activity of novel thioheterocyclic nucleoside derivatives by suppressing the c-MYC pathway

Authors - Xian-Jia Li
human

Adv Sci (Weinh)

Pericentrosomal Redistribution of the Endoplasmic Reticulum Ensures Organelle Symmetric Inheritance and Mitotic Progression

Authors - Xiangyu Xu

Adv Sci (Weinh)

A Glycoproteome Data Mining Strategy for Characterizing Structural Features of Altered Glycans with Thymic Involution

Authors - Zhida Zhang
Loading...
||
New chat

Able™

正在加载,请稍候...