Claudin 2 Polyclonal antibody

• 

  WB analysis using 26912-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26912-1-AP (Claudin 2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 26912-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26912-1-AP (Claudin 2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

Claudin 2 Polyclonal Antibody for WB, ELISA

Cat No. 26912-1-AP

Publications(15)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (3)

Applications

WB, IF, ELISA

Synonyms

CLDN2, SP82, PSEC0059

---

Tested Applications

• Positive WB detected in: A549 cells, HEK-293 cells, Caco-2 cells, HT-29 cells, HepG2 cells, PANC-1 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 10 publications below
• IF: See 6 publications below

Product Information

26912-1-AP targets Claudin 2 in WB, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat, chicken
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25527

  Product name: Recombinant human CLDN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 184-230 aa of BC014424

  Sequence: SCSSQRNRSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYV

• Full Name: claudin 2
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC014424
• Gene Symbol: Claudin 2
• Gene ID (NCBI): 9075
• RRID: AB_2918115
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P57739
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Claudin 2, also named as SP82, belongs to the claudin family. Claudin 2 is a tetraspan membrane protein consisting of two extracellular domains (ECL1 and ECL2), a small intracellular loop connecting the second and third transmembrane sections and short intracellular N and C terminal portions. Claudin 2 is a cation-selective channel forming TJ protein expressed in leaky epithelia. Claudin 2 is a 230 amino acid transmembrane protein, with a calculated molecular mass of 25 kDa (PMID: 31726679)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	J Ethnopharmacol; The rhizomes of Atractylodes macrocephala Koidz improve gastrointestinal health and pregnancy outcomes in pregnant mice via modulating intestinal barrier and water-fluid metabolism; Authors - Wang Chenxing
human	WB	Bioconjug Chem; Transforms of Cell Surface Glycoproteins Charge Influences Tumor Cell Metastasis via Atypically Inhibiting Epithelial-Mesenchymal Transition Including Matrix Metalloproteinases and Cell Junctions; Authors - Mingzhe Wang
rat	WB	Pharmaceuticals (Basel); Exploring the Underlying Mechanism of Weiling Decoction Alleviates Cold-Dampness Diarrhea Based on Network Pharmacology, Transcriptomics, Molecular Docking and Experimental Validation; Authors - Yannan Zhang
mouse	WB	Naunyn Schmiedebergs Arch Pharmacol; 5-aminosalicylic acid alleviates colitis and protects intestinal barrier function by modulating gut microbiota in mice; Authors - Jingjing Wang
mouse	IF	Front Nutr; Lactobacillus fermentum CECT5716 Alleviates the Inflammatory Response in Asthma by Regulating TLR2/TLR4 Expression; Authors - Weifang Wang
mouse	IF	Diabetes Metab Syndr Obes; Effects of Different Carbohydrate Content Diet on Gut Microbiota and Aortic Calcification in Diabetic Mice; Authors - Xinyi Shen