Tested Applications
| Positive WB detected in | bEnd.3 cells, mouse liver tissue, mouse spleen tissue |
| Positive IHC detected in | mouse liver tissue, mouse brain tissue, mouse kidney tissue, mouse spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue, mouse kidney tissue |
| Positive IF-Fro detected in | mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunohistochemistry (IHC) | IHC : 1:4000-1:16000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 18 publications below |
| IHC | See 49 publications below |
| IF | See 62 publications below |
Product Information
28083-1-AP targets CD31 in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with mouse samples.
| Tested Reactivity | mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27828 Product name: Recombinant mouse Pecam1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 51-276 aa of NM_001032378 Sequence: MISTTSKSRSQHRVLFYKDDAMVYNVTSREHTESYVIPQARVFHSGKYKCTVMLNNKEKTTIEYEVKVHGVSKPKVTLDKKEVTEGGVVTVNCSLQEEKPPIFFKIEKLEVGTKFVKRRIDKTSNENFVLMEFPIEAQDHVLVFRCQAGILSGFKLQESEPIRSEYVTVQESFSTPKFEIKPPGMIIEGDQLHIRCIVQVTHLVQEFTEIIIQKDKAIVATSKQSSE Predict reactive species |
| Full Name | platelet/endothelial cell adhesion molecule 1 |
| Calculated Molecular Weight | 81 kDa |
| Observed Molecular Weight | 110-130 kDa |
| GenBank Accession Number | NM_001032378 |
| Gene Symbol | CD31 |
| Gene ID (NCBI) | 18613 |
| RRID | AB_2881055 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q08481 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Platelet endothelial cell adhesion molecule-1 (PECAM-1, CD31) is a member of the immunoglobulin gene superfamily of cell adhesion molecules. CD31 is a transmembrane glycoprotein that is highly expressed on the surface of the endothelium, making up a large portion of its intracellular junctions. PECAM-1 is also present on the surface of hematopoietic cells and immune cells including platelets, monocytes, neutrophils, natural killer cells, megakaryocytes and some types of T-cell (PMID: 9011572). As well as its role in cell-cell adhesion, PECAM-1 functions as a signaling receptor, and is involved in important physiological events such as nitric oxide production, regulation of T-cell immunity and tolerance, leukocyte transendothelial migration and inflammation and angiogenesis (PMID: 21183735; 20978210; 17872453; 20634489).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CD31 antibody 28083-1-AP | Download protocol |
| IHC protocol for CD31 antibody 28083-1-AP | Download protocol |
| WB protocol for CD31 antibody 28083-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nanomicro Lett Gelatin-Based Metamaterial Hydrogel Films with High Conformality for Ultra-Soft Tissue Monitoring | ||
Cell Mol Biol Lett Robo4 inhibits gamma radiation-induced permeability of a murine microvascular endothelial cell by regulating the junctions | ||
Front Immunol Integrated analysis reveals crosstalk between pyroptosis and immune regulation in renal fibrosis | ||
Cells Dental Pulp Cell Transplantation Combined with Regenerative Endodontic Procedures Promotes Dentin Matrix Formation in Mature Mouse Molars | ||
J Ethnopharmacol The mechanism of Chebulae Fructus Immaturus promote diabetic wound healing based on network pharmacology and experimental verification | ||
Front Immunol "γδT Cell-IL17A-Neutrophil" Axis Drives Immunosuppression and Confers Breast Cancer Resistance to High-Dose Anti-VEGFR2 Therapy. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Georgia (Verified Customer) (11-27-2025) | Corpus callosum samples subject to western blotting with CD31 antibody at a dilution of 1:2000 incubated at room temperature for 2 hours.
|































