Use Able AI chat for product recommendations

Cathepsin B Polyclonal antibody

Cathepsin B Polyclonal Antibody for WB, IHC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, ELISA

CTSB, APP secretase, APPS, Cat B, Cathepsin B heavy chain

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for Cathepsin B in ?

Tested Applications

Positive WB detected inA375 cells, HepG2 cells, RAW 264.7 cells
Positive IP detected inHepG2 cells
Positive IHC detected inhuman lung cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

31399-1-AP targets Cathepsin B in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivitymouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Eg1020

Product name: Recombinant human Cathepsin B protein

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-10*His

Domain: 18-339 aa of NM_001908.5

Sequence: RSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI

Predict reactive species
Full Name cathepsin B
Calculated Molecular Weight38kDa
Observed Molecular Weight25 kDa and 31 kDa
GenBank Accession NumberNM_001908.5
Gene Symbol Cathepsin B
Gene ID (NCBI) 1508
RRIDAB_3669964
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity Purification
UNIPROT IDP07858
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CTSB(Cathepsin B) is also named as CPSB and belongs to the peptidase C1 family. It participates in intracellular degradation and turnover of proteins. Cathepsin B precursors found in human malignant ascites fluid do not possess mannose-rich carbohydrates suggesting that a defect in the post translational processing of carbohydrate moieties on tumor. Cathepsin B exists as both glycosylated and unglycosylated forms(PMID:1637335). In rat macrophages and hepatocytes pro- cathepsin B is 39 kDa (unglycosylated =35 kDa), whereas in human fibroblasts procathepsin B is 44.5-46kDa (unglycosylated=39kDa)(PMID:2097084). It can be detected the 43 kDa form of pro-CTSB, 31 kDa and 25 kDa mature forms in mouse brain by western blot(PMID:20616152).

Protocols

Product Specific Protocols
IHC protocol for Cathepsin B antibody 31399-1-APDownload protocol
IP protocol for Cathepsin B antibody 31399-1-APDownload protocol
WB protocol for Cathepsin B antibody 31399-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The Cathepsin B Polyclonal antibody (Cat# 31399-1-AP) has 2 citations. These publications appear in Metab Brain Dis and Cell Signal. The research fields encompass neurodegenerative disease (aggrephagy in ALS) and neuroinflammation (microglial pyroptosis and lysosomal membrane permeabilization following spinal cord injury). Both studies utilized the antibody for Western blot in mouse models.

SpeciesApplicationTitle
mouseWB

Metab Brain Dis

Unraveling the regulatory nexus of aggrephagy in ALS: identification of novel candidate biomarkers and molecular triggers.

Authors - Yingzhen Zhang
mouseWB

Cell Signal

DRAM1 activates microglial pyroptosis and neuroinflammation through TMEM9-mediated lysosomal membrane permeabilization after spinal cord injury.

Authors - Zhichao Xiong
Loading...
||
New chat

Able™

正在加载,请稍候...