COX6C Polyclonal antibody

• 

  WB analysis of human heart using 11429-2-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 11429-2-AP (COX6C antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human pancreas cancer using 11429-2-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 11429-2-AP (COX6C antibody) at dilution of 1:50 (under 10x lens).

COX6C Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11429-2-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

COX6C

---

Tested Applications

• Positive WB detected in: human heart tissue
• Positive IHC detected in: human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

11429-2-AP targets COX6C in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1982

  Product name: Recombinant human COX6C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-75 aa of BC000187

  Sequence: MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK

• Full Name: cytochrome c oxidase subunit VIc
• Calculated Molecular Weight: 75 aa, 9 kDa
• Observed Molecular Weight: 9 kDa
• GenBank Accession Number: BC000187
• Gene Symbol: COX6C
• Gene ID (NCBI): 1345
• RRID: AB_2276720
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P09669
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cytochrome c oxidase (COX) is the terminal oxidase in the respiratory chain in human and other mammalian cells. The enzyme is composed of 13 different subunits. COX6C(Cytochrome c oxidase subunit 6C) is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Biol Chem; PMID: 20870728; Authors - Oliva Claudia R CR