Tested Applications
| Positive WB detected in | human heart tissue |
| Positive IHC detected in | mouse skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:300-1:1200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11429-2-AP targets COX6C in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1982 Product name: Recombinant human COX6C protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-75 aa of BC000187 Sequence: MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK Predict reactive species |
| Full Name | cytochrome c oxidase subunit VIc |
| Calculated Molecular Weight | 75 aa, 9 kDa |
| Observed Molecular Weight | 9 kDa |
| GenBank Accession Number | BC000187 |
| Gene Symbol | COX6C |
| Gene ID (NCBI) | 1345 |
| RRID | AB_2276720 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P09669 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Cytochrome c oxidase (COX) is the terminal oxidase in the respiratory chain in human and other mammalian cells. The enzyme is composed of 13 different subunits. COX6C(Cytochrome c oxidase subunit 6C) is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for COX6C antibody 11429-2-AP | Download protocol |
| WB protocol for COX6C antibody 11429-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The COX6C Polyclonal antibody (Cat# 11429-2-AP) has 3 total citations. These appear in Apoptosis, Journal of Biological Chemistry, and Human Pathology. The research fields span endometrial cancer progression via hypoxic glycolysis and ER stress, temozolomide chemoresistance and mitochondrial electron transport chain remodeling in gliomas, and genome-wide DNA methylation profiling in pleomorphic lung carcinoma.
| Species | Application | Title |
|---|---|---|
Apoptosis Hypoxic glycolysis-driven histone lactylation activates NHE7 to promote endometrial cancer progression via COX6C-mediated endoplasmic reticulum stress.
| ||
