COX5B Polyclonal antibody

• 

  WB analysis of HeLa using 11418-2-AP

  WB result of COX5B antibody (11418-2-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-COX5B transfected HeLa cells.

• 

  WB analysis using 11418-2-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11418-2-AP (COX5B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 11418-2-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 11418-2-AP (COX5B antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 11418-2-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11418-2-AP (COX5B antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 11418-2-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using COX5B antibody (11418-2-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

• Featured Product
• KD/KO Validated

COX5B Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11418-2-AP

Publications(16)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

COXVB

---

Tested Applications

• Positive WB detected in: HeLa cells, L02 cells, mouse liver tissue, rat liver tissue
• Positive IHC detected in: human liver cancer tissue, human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 13 publications below
• IF: See 4 publications below

Product Information

11418-2-AP targets COX5B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, monkey, goat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1986

  Product name: Recombinant human COX5B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-129 aa of BC006229

  Sequence: MASRLLRGAGTLAAQALRARGPSGAAAMRSMASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLAH

• Full Name: cytochrome c oxidase subunit Vb
• Calculated Molecular Weight: 129 aa, 14 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC006229
• Gene Symbol: COX5B
• Gene ID (NCBI): 1329
• RRID: AB_2245376
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P10606
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

COX5B belongs to the cytochrome c oxidase subunit 5B family. It is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. COX5B and other 3 genes CKB, HBB, MBP are involved in respiration.(PMID:21295140)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nature; A cytosolic surveillance mechanism activates the mitochondrial UPR; Authors - F X Reymond Sutandy
mouse	WB	Nature; Mechanism of super-assembly of respiratory complexes III and IV.; Authors - Sara Cogliati
human	WB	Cell; Mitochondrial Protein Synthesis Adapts to Influx of Nuclear-Encoded Protein.; Authors - Ricarda Richter-Dennerlein ; KD Validated
mouse	WB	Nat Immunol; Mitochondrial respiratory-chain adaptations in macrophages contribute to antibacterial host defense.; Authors - Johan Garaude
human	WB	Cell Metab; Enhanced Respiratory Chain Supercomplex Formation in Response to Exercise in Human Skeletal Muscle.; Authors - Chiara Greggio
human	WB	Mol Cell; Global mitochondrial protein import proteomics reveal distinct regulation by translation and translocation machinery; Authors - Jasmin Adriana Schafer

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Süleyman (Verified Customer) (02-07-2022)

HeLa cell line is used and even though it has some unspecific bands but it is very specific and the unspecific bands are very distant. Recommended!

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: HeLa

COX5B Antibody Western Blot validation (1:1000 dilution) in HeLa (Cat no:11418-2-AP)