Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

COX4I2 Polyclonal antibody

COX4I2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 11463-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

COX IV 2, COX IV-2, COX4, COX4 2, COX4B

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Filter:
  • Western Blot (WB) analysis of various lysates using COX4I2 Polyclonal antibody (11463-1-AP)

    WB analysis using 11463-1-AP

    Various lysates were subjected to SDS PAGE followed by western blot with 11463-1-AP (COX4I2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of various lysates using COX4I2 Polyclonal antibody (11463-1-AP)

    WB analysis using 11463-1-AP

    Various lysates were subjected to SDS PAGE followed by western blot with 11463-1-AP (COX4I2 antibody) at dilution of 1:1500 incubated at 4 degree celsius over night.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of various lysates using COX4I2 Polyclonal antibody (11463-1-AP)

    WB analysis using 11463-1-AP

    Various lysates were subjected to SDS PAGE followed by western blot with 11463-1-AP (COX4I2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of HepG2 cells using COX4I2 Polyclonal antibody (11463-1-AP)

    WB analysis of HepG2 using 11463-1-AP

    HepG2 cells were subjected to SDS PAGE followed by western blot with 11463-1-AP (COX4I2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of A375 cells using COX4I2 Polyclonal antibody (11463-1-AP)

    WB analysis of A375 using 11463-1-AP

    A375 cells were subjected to SDS PAGE followed by western blot with 11463-1-AP (COX4I2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of MCF-7 cells using COX4I2 Polyclonal antibody (11463-1-AP)

    WB analysis of MCF-7 using 11463-1-AP

    MCF7 cells were subjected to SDS PAGE followed by western blot with 11463-1-AP (COX4I2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of human brain tissue using COX4I2 Polyclonal antibody (11463-1-AP)

    WB analysis of human brain using 11463-1-AP

    human brain tissue were subjected to SDS PAGE followed by western blot with 11463-1-AP (COX4I2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunoprecipitation (IP) experiment using COX4I2 Polyclonal antibody (11463-1-AP)

    IP experiment using 11463-1-AP

    IP result of anti-COX4I2 (11463-1-AP for IP and Detection) with HepG2 cell lysate.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunoprecipitation (IP) experiment of HepG2 cells using COX4I2 Polyclonal antibody (11463-1-AP)

    IP experiment of HepG2 using 11463-1-AP

    IP result of anti-COX4I2 (IP:11463-1-AP, 3ug; Detection:11463-1-AP 1:1000) with HepG2 cells lysate 8000ug.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of human ovary tumor tissue using COX4I2 Polyclonal antibody (11463-1-AP)

    IHC staining of human ovary tumor using 11463-1-AP

    Immunohistochemical analysis of paraffin-embedded human ovary tumor using 11463-1-AP (COX4I2 antibody) at dilution of 1:50 (under 10x lens).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunofluorescence (IF) / fluorescent staining of HeLa cells using COX4I2 Polyclonal antibody (11463-1-AP)

    IF Staining of HeLa using 11463-1-AP

    Immunofluorescent analysis of (4% PFA) fixed HeLa cells using COX4I2 antibody (11463-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunofluorescence (IF) / fluorescent staining of HepG2 cells using COX4I2 Polyclonal antibody (11463-1-AP)

    IF Staining of HepG2 using 11463-1-AP

    Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using COX4I2 antibody (11463-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

"COX4I2 Antibodies" Comparison

View side-by-side comparison of COX4I2 antibodies from other vendors to find the one that best suits your research needs.

Tested Applications

Positive WB detected inHepG2 cells, A375 cells, human brain tissue, MCF-7 cells, mouse heart tissue
Positive IP detected inHepG2 cells
Positive IHC detected inhuman ovary tumor tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11463-1-AP targets COX4I2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1987

Product name: Recombinant human COX4I2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-171 aa of BC057779

Sequence: MLPRAAWSLVLRKGGGGRRGMHSSEGTTRGGGKMSPYTNCYAQRYYPMPEEPFCTELNAEEQALKEKEKGSWTQLTHAEKVALYRLQFNETFAEMNRRSNEWKTVMGCVFFFIGFAALVIWWQRVYVFPPKPITLTDERKAQQLQRMLDMKVNPVQGLASRWDYEKKQWKK

Predict reactive species
Full Name cytochrome c oxidase subunit IV isoform 2 (lung)
Calculated Molecular Weight 171 aa, 20 kDa
Observed Molecular Weight 17-18 kDa
GenBank Accession NumberBC057779
Gene Symbol COX4I2
Gene ID (NCBI) 84701
RRIDAB_2085287
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96KJ9
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

COX4I2, also named as COX4L2 and COXIV-2, belongs to the cytochrome c oxidase IV family. It is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. COXIV(cytochrome c oxidase IV) has two isoforms (isoform 1 and 2). Isoform 1(COX4I1) is ubiquitously expressed and isoform 2 is highly expressed in lung tissues. This antibody was generated against full length COX4I2 protein.

Protocols

Product Specific Protocols
IF protocol for COX4I2 antibody 11463-1-APDownload protocol
IHC protocol for COX4I2 antibody 11463-1-APDownload protocol
IP protocol for COX4I2 antibody 11463-1-APDownload protocol
WB protocol for COX4I2 antibody 11463-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
mouseWB

Cell Rep

Defective Mitochondrial Cardiolipin Remodeling Dampens HIF-1α Expression in Hypoxia.

Authors - Arpita Chowdhury
humanWB

Oncotarget

Nuclear-encoded cytochrome c oxidase subunit 4 regulates BMI1 expression and determines proliferative capacity of high-grade gliomas.

Authors - Claudia R Oliva
  • KD Validated
mouseIF

Sci Signal

Acute O2 sensing through HIF2α-dependent expression of atypical cytochrome oxidase subunits in arterial chemoreceptors.

Authors - Alejandro Moreno-Domínguez
  • KO Validated
humanWB

Free Radic Biol Med

Cytochrome c oxidase mediates labile iron level and radioresistance in glioblastoma.

Authors - Md Yousuf Ali
humanWB

Bioconjug Chem

GnRH-Gemcitabine Conjugates for the Treatment of Androgen-Independent Prostate Cancer: Pharmacokinetic Enhancements Combined with Targeted Drug Delivery.

Authors - Theodoros Karampelas
humanWB

Free Radic Biol Med

Differentiation of SH-SY5Y cells to a neuronal phenotype changes cellular bioenergetics and the response to oxidative stress.

Authors - Schneider Lonnie L

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Vignesh (Verified Customer) (09-19-2025)

The results are excellent, bands are clear

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: HTR cells
Loading...
||
New chat

Able™

正在加载,请稍候...