Collagen Type I Polyclonal antibody

The Collagen Type I polyclonal antibody (14695-1-AP) is one of the most highly cited Collagen Type I antibodies in the market. It is suitable for WB, IHC, FC (Intra), IP, ELISA and has been referenced in over 1,220 publications.
Cat No. 14695-1-AP
Publications(1220)

Host / Isotype

Rabbit / IgG

Reactivity

human, pig and More (8)

Applications

WB, IHC, IF, FC (Intra), IP, CoIP, ELISA

COL1, COL1A2, Alpha-2 type I collagen, col I, Collagen alpha 2(I) chain

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inpig skin tissue, human placenta tissue, MG-63 cells, Saos-2 cells, U-87 MG cells
Positive IP detected inU-87 MG cells
Positive IHC detected inhuman skin cancer tissue, human colon tissue, human oesophagus cancer tissue, human placenta tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inSW480 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14695-1-AP targets Collagen Type I in WB, IHC, IF, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, pig samples.

Tested Reactivity human, pig
Cited Reactivityhuman, mouse, rat, pig, rabbit, canine, chicken, bovine, toad, duck
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6281

Product name: Recombinant human COL1A2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1017-1366 aa of BC054498

Sequence: RGLPGLKGHNGLQGLPGIAGHHGDQGAPGSVGPAGPRGPAGPSGPAGKDGRTGHPGTVGPAGIRGPQGHQGPAGPPGPPGPPGPPGVSGGGYDFGYDGDFYRADQPRSAPSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCFK

Predict reactive species
Full Name collagen, type I, alpha 2
Calculated Molecular Weight 1366 aa, 130 kDa
Observed Molecular Weight130-150 kDa
GenBank Accession NumberBC054498
Gene Symbol COL1A2
Gene ID (NCBI) 1278
RRIDAB_2082037
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP08123
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Type I collagen, the major structural component of connective tissues such as skin, tendon and bone, is the most abundant and widely expressed collagen in humans (PMID: 7620364; 8645190; 9016532). Type I collagen is a heterotrimer comprising one alpha 2(I) and two alpha 1(I) chains which are encoded by the unlinked loci COL1A2 and COL1A1 respectively. Type I collagen has a molecular mass of about 250-300 kDa, while the alpha 2(I) chain has a molecular weight of about 100-140 kDa. Mutations in COL1A2 gene are associated with osteogenesis imperfecta, Ehlers-Danlos syndrome, idiopathic osteoporosis, and atypical Marfan syndrome. This antibody raised against 1017-1366 aa of human pro-alpha 2 chain of type l collagen can recognize collagen alpha 2(1) chain and C-terminal propeptide of pro-alpha 2(1) chain.

Protocols

Product Specific Protocols
WB protocol for Collagen Type I antibody 14695-1-APDownload protocol
IHC protocol for Collagen Type I antibody 14695-1-APDownload protocol
IP protocol for Collagen Type I antibody 14695-1-APDownload protocol
FC protocol for Collagen Type I antibody 14695-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Cancer Cell

Single-cell multi-stage spatial evolutional map of esophageal carcinogenesis

Authors - Jiang Chang
ratIF

Adv Mater

Acid-Induced in Situ Phase Separation and Percolation for Constructing Bi-Continuous Phase Hydrogel Electrodes With Motion-Insensitive Property

Authors - Qingquan Han
mouseWB

Gastroenterology

Pancreatic acinar cells-derived sphingosine-1-phosphate contributes to fibrosis of chronic pancreatitis via inducing autophagy and activation of pancreatic stellate cells

Authors - Decai Wang
rabbitIF

Adv Mater

A Superparamagnetic Composite Hydrogel Scaffold as in Vivo Dynamic Monitorable Theranostic Platform for Osteoarthritis Regeneration

Authors - Mayifei Rong
mouseWB

Gut

Histone methyltransferase Suv39h1 regulates hepatic stellate cell activation and is targetable in liver fibrosis

Authors - Ming Kong
humanWB

Bioact Mater

3D Printed Biomimetic Metamaterials with Graded Porosity and Tapering Topology for Improved Cell Seeding and Bone Regeneration

Authors - Lei Zhang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

p (Verified Customer) (09-23-2024)

Excellent

  • Applications: Western Blot
  • Primary Antibody Dilution: 1000
  • Cell Tissue Type: HEK
Collagen Type I Antibody Western Blot validation (1000 dilution) in HEK (Cat no:14695-1-AP)
FH

Brice-Emmanuel (Verified Customer) (10-12-2023)

I have 2 bands in 70 kDa

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: Mouse Heart Tissue
Collagen Type I Antibody Western Blot validation (1/1000 dilution) in Mouse Heart Tissue (Cat no:14695-1-AP)
FH

S (Verified Customer) (03-20-2023)

Excellent Antibody!

  • Applications: Western Blot
  • Primary Antibody Dilution: 1000
  • Cell Tissue Type: fibroblast
Collagen Type I Antibody Western Blot validation (1000 dilution) in fibroblast (Cat no:14695-1-AP)
FH

Balawant Kumar (Verified Customer) (12-20-2022)

antibody is working great. I have used this antibody for mice colon tissue and colon cancer cell line

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: colon tissue and colon cancer cell line (caco2, HCT116)
FH

PK (Verified Customer) (07-08-2022)

Very Good

  • Applications: Western Blot
  • Cell Tissue Type: Fibroblast
Collagen Type I Antibody Western Blot validation ( dilution) in Fibroblast (Cat no:14695-1-AP)
FH

Ren Jie (Verified Customer) (06-22-2022)

Very strong signal for collagen I, needs stringent wash conditions to minimize ladder staining in western blot

  • Applications: Western Blot, Other
  • Primary Antibody Dilution: 1:1000
FH

S (Verified Customer) (12-01-2021)

Excellent

  • Applications: Western Blot
  • Cell Tissue Type: LUNG FIBROBLASTS
Collagen Type I Antibody Western Blot validation ( dilution) in LUNG FIBROBLASTS (Cat no:14695-1-AP)
FH

Hala (Verified Customer) (02-23-2021)

very good

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000
FH

Eistine (Verified Customer) (05-31-2019)

The antibody works pretty good

  • Applications: Immunofluorescence,
Loading...
||
New chat Able
正在加载,请稍候...