Clusterin Monoclonal antibody

• 

  WB analysis of human plasma using 66109-1-Ig

  human plasma were subjected to SDS PAGE followed by western blot with 66109-1-Ig (Clusterin antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 66109-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver slide using 66109-1-Ig (Clusterin antibody at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human liver using 66109-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver slide using 66109-1-Ig (Clusterin antibody at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human breast cancer using 66109-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer slide using 66109-1-Ig (Clusterin antibody at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human breast cancer using 66109-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer slide using 66109-1-Ig (Clusterin antibody at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human prostate cancer using 66109-1-Ig

  Immunohistochemical analysis of paraffin-embedded human prostate cancer slide using 66109-1-Ig (Clusterin antibody at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human prostate cancer using 66109-1-Ig

  Immunohistochemical analysis of paraffin-embedded human prostate cancer slide using 66109-1-Ig (Clusterin antibody at dilution of 1:50 (under 40x lens).

Clusterin Monoclonal Antibody for WB, IHC, ELISA

Cat No. 66109-1-Ig

Clone No.2F12G10

Reviews (1)

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

Apo-J, APOJ, Apo J, Aging-associated gene 4 protein, AAG4

---

Tested Applications

• Positive WB detected in: human plasma
• Positive IHC detected in: human liver tissue, human breast cancer tissue, human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66109-1-Ig targets Clusterin in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19236

  Product name: Recombinant human CLU protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 101-449 aa of BC010514

  Sequence: VCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE

• Full Name: clusterin
• Calculated Molecular Weight: 449 aa, 53 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC010514
• Gene Symbol: CLU
• Gene ID (NCBI): 1191
• RRID: AB_2881508
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P10909
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Clusterin (Apolipoprotein J) is a 75-80 kDa heterodimeric glycoprotein produced by a wide array of tissues and found in most biologic fluids (PMID: 7648419; 11906815). It is encoded by one single gene and cleaved posttranslationally into α (34-36 kDa) and β (36-39 kDa) subunits prior to secretion from the cell. Many functions have been described for clusterin, including regulating apoptosis, transporting lipids, controlling cell interactions, regulating complement (PMID: 10694874).

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Christine (Verified Customer) (08-05-2025)

Detects 2 bands in total cell lysates of HEK293T (between 25 and 35 kDa) but nothing in the supernatant (I was expecting its secretion), so I am not sure whether it works or not

• Applications: Western Blot
• Primary Antibody Dilution: 1:2,000