Clusterin Monoclonal antibody

Clusterin Monoclonal Antibody for WB, IHC, ELISA
Cat No. 66109-1-Ig
Clone No.2F12G10

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, ELISA

Apo-J, APOJ, Apo J, Aging-associated gene 4 protein, AAG4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman plasma
Positive IHC detected inhuman liver tissue, human breast cancer tissue, human prostate cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66109-1-Ig targets Clusterin in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag19236

Product name: Recombinant human CLU protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 101-449 aa of BC010514

Sequence: VCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE

Predict reactive species
Full Name clusterin
Calculated Molecular Weight 449 aa, 53 kDa
Observed Molecular Weight 36 kDa
GenBank Accession NumberBC010514
Gene Symbol CLU
Gene ID (NCBI) 1191
RRIDAB_2881508
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP10909
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Clusterin (Apolipoprotein J) is a 75-80 kDa heterodimeric glycoprotein produced by a wide array of tissues and found in most biologic fluids (PMID: 7648419; 11906815). It is encoded by one single gene and cleaved posttranslationally into α (34-36 kDa) and β (36-39 kDa) subunits prior to secretion from the cell. Many functions have been described for clusterin, including regulating apoptosis, transporting lipids, controlling cell interactions, regulating complement (PMID: 10694874).

Protocols

Product Specific Protocols
IHC protocol for Clusterin antibody 66109-1-IgDownload protocol
WB protocol for Clusterin antibody 66109-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Christine (Verified Customer) (08-05-2025)

Detects 2 bands in total cell lysates of HEK293T (between 25 and 35 kDa) but nothing in the supernatant (I was expecting its secretion), so I am not sure whether it works or not

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2,000
Loading...
||
New chat Able
正在加载,请稍候...