CHMP1B Polyclonal antibody

• 

  WB analysis using 14639-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14639-1-AP (CHMP1B antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 14639-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14639-1-AP (CHMP1B antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 14639-1-AP

  IP result of anti-CHMP1B (IP:14639-1-AP, 4ug; Detection:14639-1-AP 1:300) with HeLa cells lysate 880ug.

• 

  IHC staining of human kidney using 14639-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 14639-1-AP (CHMP1B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 14639-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 14639-1-AP (CHMP1B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CHMP1B Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 14639-1-AP

Publications(12)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

Chromatin-modifying protein 1b, chromatin modifying protein 1B, CHMP1.5, C18orf2, C18 ORF2

---

Tested Applications

• Positive WB detected in: A431 cells, human heart tissue, mouse heart tissue, rat heart tissue, HeLa cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below
• IF: See 8 publications below

Product Information

14639-1-AP targets CHMP1B in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6222

  Product name: Recombinant human CHMP1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-199 aa of BC065933

  Sequence: MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSVASAEQDELSQRLARLRDQV

• Full Name: chromatin modifying protein 1B
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC065933
• Gene Symbol: CHMP1B
• Gene ID (NCBI): 57132
• RRID: AB_2079353
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7LBR1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IF	Science; Triggered recruitment of ESCRT machinery promotes endolysosomal repair.; Authors - Michael L Skowyra
human	IF	Nat Cell Biol; Endosomal membrane tension regulates ESCRT-III-dependent intra-lumenal vesicle formation.; Authors - Vincent Mercier
human	WB	J Extracell Vesicles; Accessory ESCRT-III proteins are conserved and selective regulators of Rab11a-exosome formation; Authors - Pauline P Marie
human	IF, WB	Dev Cell; NPC1-mTORC1 Signaling Couples Cholesterol Sensing to Organelle Homeostasis and Is a Targetable Pathway in Niemann-Pick Type C.; Authors - Oliver B Davis
human	IF	Elife (Cambridge); Structure of cellular ESCRT-III spirals and their relationship to HIV budding.; Authors - Anil G Cashikar
human,mouse	IF	MBio; Mycobacterium tuberculosis Type VII Secretion System Effectors Differentially Impact the ESCRT Endomembrane Damage Response.; Authors - Ekansh Mittal