Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CHDH Polyclonal antibody

CHDH Polyclonal Antibody for WB, IHC, ELISA

Cat No. 17356-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

CDH, CHD, CHDH, Choline dehydrogenase

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inrat liver tissue, mouse kidney tissue, mouse liver tissue
Positive IHC detected inhuman liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:6000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17356-1-AP targets CHDH in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag10614

Product name: Recombinant human CHDH protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 244-594 aa of BC034502

Sequence: YLHPALSRTNLKAEAETLVSRVLFEGTRAVGVEYVKNGQSHRAYASKEVILSGGAINSPQLLMLSGIGNADDLKKLGIPVVCHLPGVGQNLQDHLEIYIQQACTRPITLHSAQKPLRKVCIGLEWLWKFTGEGATAHLETGGFIRSQPGVPHPDIQFHFLPSQVIDHGRVPTQQEAYQVHVGPMRGTSVGWLKLRSANPQDHPVIQPNYLSTETDIEDFRLCVKLTREIFAQEALAPFRGKELQPGSHIQSDKEIDAFVRAKADSAYHPSCTCKMGQPSDPTAVVDPQTRVLGVENLRVVDASIMPSMVSGNLNAPTIMIAEKAADIIKGQPALWDKDVPVYKPRTLATQR

Predict reactive species
Full Name choline dehydrogenase
Calculated Molecular Weight 594 aa, 65 kDa
Observed Molecular Weight 60 kDa
GenBank Accession NumberBC034502
Gene Symbol CHDH
Gene ID (NCBI) 55349
RRIDAB_2276253
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8NE62
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CHDH(Choline dehydrogenase, mitochondrial) is also named as CDH,CHD and belongs to the GMC oxidoreductase family. CHDH is a member of the glucose-methanol-choline family of oxidoreductases, with each member containing a consensus FAD-binding domain. Many members of this oxidoreductase family are soluble proteins but mammalian CHDH is associated with the inner mitochondrial membrane(Handbook of vitamins,Robert B,2007). The full length protein(65 kDa) has a transit peptide of 29 amino acid and the mature CHDH is appropriately located in the inner mitochondria membrane(PMID:12951056). 17356-1-AP can also recognize the 45 kDa isoform X3 of CHDH.

Protocols

Product Specific Protocols
IHC protocol for CHDH antibody 17356-1-APDownload protocol
WB protocol for CHDH antibody 17356-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
mouseWB

J Biol Chem

Betaine is accumulated via transient choline dehydrogenase activation during Mouse oocyte meiotic maturation.

Authors - Taylor McClatchie
  • KO Validated
humanIHC

PLoS One

Choline dehydrogenase polymorphism rs12676 is a functional variation and is associated with changes in human sperm cell function.

Authors - Johnson Amy R AR
humanIHC

Transl Oncol

Quantitative proteomic profiling of hepatocellular carcinoma at different serum alpha-fetoprotein level.

Authors - Xuyong Wei
human,mouseWB,IF

Aging (Albany NY)

Mitochondrial-related genes PDK2, CHDH, and ALDH5A1 served as a diagnostic signature and correlated with immune cell infiltration in ulcerative colitis

Authors - Qian Yang

Poult Sci

Global and mitochondrial choline dehydrogenase contribute to goose fatty liver formation by differentially regulating energy metabolism, autophagy and oxidative stress related pathways.

Authors - Xiaoyi Zhou
humanIF

Sci Adv

Maintaining hypoxia environment of subchondral bone alleviates osteoarthritis progression

Authors - Hao Zhang

Reviews

    4.5 out of 5
Add a review

2 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Wojciech (Verified Customer) (03-23-2023)

A band was detected at around 60 kDa. 30 ug of protein was loaded and probed with the antibody at 1:2000 dilution.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: T-ALL cell line (CCRF-CEM)

Hua (Verified Customer) (12-04-2018)

40 ug of mouse liver lysate was loaded onto the gel. The incubation time is over night at 4oC.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: mouse liver
CHDH Antibody Western Blot, validation (1:1000 dilution) in mouse liver (Cat no:17356-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...