Tested Applications
| Positive WB detected in | Jurkat cells, HeLa cells |
| Positive IP detected in | Jurkat cells |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
17037-1-AP targets CHAF1A in WB, IHC, IF, IP, ChIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag10536 Product name: Recombinant human CHAF1A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 607-956 aa of BC067093 Sequence: EEPGESLSHSEGDDDDDMGEDEDEDDGFFVPHGYLSEDEGVTEECADPENHKVRQKLKAKEWDEFLAKGKRFRVLQPVKIGCVWAADRDCAGDDLKVLQQFAACFLETLPAQEEQTPKASKRERRDEQILAQLLPLLHGNVNGSKVIIREFQEHCRRGLLSNHTGSPRSPSTTYLHTPTPSEDAAIPSKSRLKRLISENSVYEKRPDFRMCWYVHPQVLQSFQQEHLPVPCQWSYVTSVPSAPKEDSGSVPSTGPSQGTPISLKRKSAGSMCITQFMKKRRHDGQIGAEDMDGFQADTEEEEEEEGDCMIVDVPDAAEVQAPCGAASGAGGGVGVDTGKATLTASPLGAS Predict reactive species |
| Full Name | chromatin assembly factor 1, subunit A (p150) |
| Calculated Molecular Weight | 956 aa, 107 kDa |
| Observed Molecular Weight | 150 kDa |
| GenBank Accession Number | BC067093 |
| Gene Symbol | CHAF1A |
| Gene ID (NCBI) | 10036 |
| RRID | AB_2291707 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13111 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Chromatin assembly factor 1 (CAF1) is the only histone chaperone known to assemble histones H3 and H4 onto newly synthesized DNA both in vitro and in vivo [PMID:17065558]. The 938 amino acid multidomain p150 (CHAF1A) binds via its C-terminal third to p60, which is an essential step for nucleosome assembly because knocking down either subunit disrupts the activity [PMID:14519857]. In addition, CAF1 facilitates DNA synthesis depending on the binding of the N-terminal 31 residues of p150 to the proliferating cell nuclear antigen (PCNA), which acts as a sliding clamp to stimulate the processivity of DNA polymerase [PMID:10648606]. CHAF1A regulates the formation of heterochromatin in mammalian cells during replication and in plants it maintains the transcription of certain subsets of genes. Furthermore, CHAF1A exists in a chromatin-remodeling complex WINAC, which coactivates ligand-induced transactivation function of the vitamin D receptor [PMID:12837248]. CHAF1A protein exists some phosphorylation sites, which may affect its theoretical molecular weight when tested.And a 150 kDa band was recognized (PMID:27445493).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CHAF1A antibody 17037-1-AP | Download protocol |
| IP protocol for CHAF1A antibody 17037-1-AP | Download protocol |
| WB protocol for CHAF1A antibody 17037-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-CHAF1A antibody (Cat# 17037-1-AP) has 11 citations across journals including Cell Death & Disease, Nature Structural & Molecular Biology, Oncogene, EMBO Journal, Genes & Development, Cancers, Biomedicines, Frontiers in Molecular Biosciences, Journal of Biological Chemistry, Journal of Virology, and Reproductive Sciences. Research fields span cancer biology (gastric and esophageal cancer), HIV-1 latency, chromatin assembly, histone chaperone function, nucleosome remodeling, homologous recombination, early embryonic development, and gestational diabetes.
| Species | Application | Title |
|---|---|---|
Cell Death Dis Chromatin assembly factor 1 subunit A promotes TLS pathway by recruiting E3 ubiquitin ligase RAD18 in cancer cells | ||
Nat Struct Mol Biol Reprogramming of the histone H3.3 landscape in the early mouse embryo. | ||
Oncogene CHAF1A promotes RAD51 loading and homologous recombination to drive tumor radioresistance. | ||
EMBO J Histone chaperone CAF-1 promotes HIV-1 latency by leading the formation of phase-separated suppressive nuclear bodies.
| ||
Genes Dev Dynamic nucleosome remodeling mediated by YY1 underlies early mouse development
| ||
Cancers (Basel) Human Ccr4 and Caf1 Deadenylases Regulate Proliferation and Tumorigenicity of Human Gastric Cancer Cells via Modulating Cell Cycle Progression.
|
Reviews
What customers say
Both reviewers report positive results. One user performed Western Blot on B cell lines at a 1:1000 dilution and observed a clear single band, noting the results matched expectations from prior proteomics experiments. Another user used the antibody for Immunofluorescence on HeLa cells at 1:300, describing a protocol involving 5-minute pre-extraction, 4% PFA fixation, 5% FBS blocking, and overnight primary antibody incubation. Overall, the antibody is well-received for both WB and IF applications, with users highlighting clear, specific signal and reliable performance.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Annabel (Verified Customer) (02-12-2026) | Showed a clear single band in B cell lines, treated with activators. Results were as expected from proteomics experiments.
|
Hasan (Verified Customer) (05-17-2023) | HeLa cells were pre-extracted for 5 mins then fixed with 4% PFA for 15 mins. Blocking with 5% FBS for 40 min and primary antibody incubation overnight.
 |
