Tested Applications
| Positive WB detected in | LNCaP cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue, SH-SY5Y cells, A431 cells, PC-12 cells, Neuro-2a cells |
| Positive IHC detected in | human testis tissue, human lung cancer tissue, human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 25 publications below |
| IF | See 6 publications below |
| IP | See 2 publications below |
Product Information
66057-1-Ig targets Cofilin in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.
| Tested Reactivity | human, mouse, rat, pig, rabbit |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18044 Product name: Recombinant human Cofilin protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-166 aa of BC012318 Sequence: MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL Predict reactive species |
| Full Name | cofilin 1 (non-muscle) |
| Calculated Molecular Weight | 18 kDa |
| Observed Molecular Weight | 18 kDa |
| GenBank Accession Number | BC012318 |
| Gene Symbol | Cofilin |
| Gene ID (NCBI) | 1072 |
| RRID | AB_11043339 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P23528 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Cofilin is a ubiquitous actin-binding protein required for the reorganization of actin filaments. It is a member of ADF (actin-depolymerizing factor)/cofilin family that is a key regulator of actin dynamics and essential for cellular motility, cytokinesis, and endocytosis. Cofilin activity is tightly regulated by phosphorylation and dephosphorylation. Phosphorylation at Ser3 can inhibit its activity, also causing translocation from the nucleus to the cytoplasm.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for Cofilin antibody 66057-1-Ig | Download protocol |
| IF protocol for Cofilin antibody 66057-1-Ig | Download protocol |
| IHC protocol for Cofilin antibody 66057-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun N-terminal α-amino SUMOylation of cofilin-1 is critical for its regulation of actin depolymerization | ||
Mol Psychiatry Phosphoproteomic of the acetylcholine pathway enables discovery of the PKC-β-PIX-Rac1-PAK cascade as a stimulatory signal for aversive learning. | ||
Nat Commun Nuclear-capture of endosomes depletes nuclear G-actin to promote SRF/MRTF activation and cancer cell invasion. | ||
Nat Commun Dendritic autophagy degrades postsynaptic proteins and is required for long-term synaptic depression in mice. | ||
Elife Giant ankyrin-B mediates transduction of axon guidance and collateral branch pruning factor sema 3A | ||
Int J Nanomedicine Protein Nanoparticle-Related Osmotic Pressure Modifies Nonselective Permeability of the Blood-Brain Barrier by Increasing Membrane Fluidity. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Udesh (Verified Customer) (08-19-2024) | Worked well at 1:3000
![]() |
FH Marina (Verified Customer) (03-12-2024) | Samples are two tumour (glioblastoma) cell lines (TC1, TC2). Gradient gel 4-15 %. Dilution 1:5000, primary antibody incubation 4ºC overnight, secondary antibody incubation 1 h room temperature. The bands appear at the expected size of the target protein.
![]() |





















