CD8b Monoclonal antibody, PBS Only

CD8b Monoclonal Antibody for IHC, Indirect ELISA
Cat No. 68432-1-PBS
Clone No.4B3B8

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IHC, Indirect ELISA

CD8, 4B3B8, Ly3, Leu2, CD8B1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68432-1-PBS targets CD8b in IHC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag16925

Product name: Recombinant human CD8B protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 22-171 aa of BC100913

Sequence: LQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPI

Predict reactive species
Full Name CD8b molecule
Calculated Molecular Weight 243 aa, 27 kDa
GenBank Accession NumberBC100913
Gene Symbol CD8B
Gene ID (NCBI) 926
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP10966
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CD8b (T-cell surface glycoprotein CD8 beta chain) is an integral membrane glycoprotein that forms disulfide-linked heterodimers with CD8a (CD8 alpha chain). The CD8 alpha/beta heterodimer is the predominant CD8 complex expressed on the cell surface (PMID: 1534146; 2111591). CD8 is a transmembrane glycoprotein predominantly expressed on cytotoxic T cells and can also be found on natural killer cells, cortical thymocytes, and dendritic cells. CD8 serves as a co-receptor for the T cell receptor (TCR). Both CD8 and TCR recognize antigens displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. CD8 plays a role in T cell development and activation of mature T cells.

Loading...
||
New chat Able
正在加载,请稍候...