CD81 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CD81 Polyclonal antibody (27855-1-AP)

• Featured Product
• KD/KO Validated

CD81 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27855-1-AP

Publications(189)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (3)

Applications

WB, IHC, IF, ELISA

Synonyms

26 kDa cell surface protein TAPA-1, CD81 antigen, CD81 molecule, S5.7, TAPA1

• 

  WB analysis of HCT 116 using 27855-1-AP

  WB result of CD81 antibody (27855-1-AP; 1:600; room temperature for 1.5 hours) with wild-type and CD81 knockout HCT 116 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 27855-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27855-1-AP (CD81 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 27855-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 27855-1-AP (CD81 antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 27855-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 27855-1-AP (CD81 antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: Jurkat cells, HCT 116 cells, Raji cells, Ramos cells, THP-1 cells, mouse brain tissue, rat brain tissue
• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27855-1-AP targets CD81 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, canine, zebrafish, bovine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27298

  Product name: Recombinant human CD81 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 114-199 aa of BC002978

  Sequence: VNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFS

• Full Name: CD81 molecule
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC002978
• Gene Symbol: CD81
• Gene ID (NCBI): 975
• ENSEMBL Gene ID: ENSG00000110651
• RRID: AB_2880995
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P60033
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD81 (also known as TAPA1or TSPAN28) is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Many of these members are expressed on leukocytes and have been implicated in signal transduction, cell-cell interactions, and cellular activation and development. CD81 is involved in signal transduction and cell adhesion in the immune system (PMID: 9597125). CD81 has also been identified as an essential receptor for HCV (hepatitis C virus) (PMID: 21428934).

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell; Transplantation of gasdermin pores by extracellular vesicles propagates pyroptosis to bystander cells; Authors - Skylar S Wright
human, mouse	WB	Mol Cancer; LncRNA NEAT1 promotes immunosuppression in gastric cancer under endoplasmic reticulum stress by maintaining the M(6)A methylation of SEMA3A in CAFs.; Authors - Youqin Xu
mouse	WB	Nat Nanotechnol; Intracerebral fate of organic and inorganic nanoparticles is dependent on microglial extracellular vesicle function; Authors - Jinchao Gao
human		Nat Biomed Eng; Rapid and sensitive detection of cancer-derived small extracellular vesicles using Janus particles.; Authors - Sonu Kumar
		Nat Aging; Extracellular vesicles derived from senescent hepatocytes drive pan-cancer metastasis in aging; Authors - Huilong Li
human	WB	Bioact Mater; AntagomiR-192-5p-engineered exosomes encapsulated in MXene-modified GelMA hydrogel facilitated epithelization of burn wounds by targeting OLFM4.; Authors - Wenzhang Liu