CD70 Monoclonal antibody

• 

  WB analysis using 67749-1-Ig

  THP-1 cells were subjected to SDS PAGE followed by western blot with 67749-1-Ig (CD70 antibody) at dilution of 1:1000, 2000, 4000 and 8000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human tonsillitis using 67749-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67749-1-Ig (CD70 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 67749-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67749-1-Ig (CD70 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human tonsillitis using 67749-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CD70 antibody (67749-1-Ig, Clone: 1A11A10 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

CD70 Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 67749-1-Ig

Clone No.1A11A10

Publications(4)

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF-P, ELISA

Synonyms

1A11A10, CD27 L, CD27 ligand, CD27L, CD27-L

---

Tested Applications

• Positive WB detected in: THP-1 cells
• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human tonsillitis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:400-1:1600
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 3 publications below
• IF: See 1 publications below

Product Information

67749-1-Ig targets CD70 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28070

  Product name: Recombinant human CD70 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-193 aa of BC000725

  Sequence: MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP

• Full Name: CD70 molecule
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC000725
• Gene Symbol: CD70
• Gene ID (NCBI): 970
• RRID: AB_2918518
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P32970
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Int J Cancer; Special issue "The advance of solid tumor research in China": Multi-omics analysis based on 1311 clear cell renal cell carcinoma samples identifies a glycolysis signature associated with prognosis and treatment response; Authors - Xi Tian
human	IHC	Aging (Albany NY); Predicting the prognosis of glioma patients with TERT promoter mutations and guiding the specific immune profile of immune checkpoint blockade therapy; Authors - Wenpeng Cao
human	IHC	Cancer Lett; Comprehensive molecular characterization of long-term glioblastoma survivors; Authors - Hao Xu
human	IF	Blood Adv; CD70 identifies alloreactive T cells and represents a potential target for prevention and treatment of acute GvHD; Authors - Kriti Verma