Use Able AI chat for product recommendations

CD34 Polyclonal antibody

CD34 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 14486-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (5)

Applications

WB, IHC, IF-P, ELISA

CD34 molecule

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite®594
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHL-60 cells, TF-1 cells
Positive IHC detected inhuman tonsillitis tissue, human gliomas tissue, human hysteromyoma tissue, human liver cancer tissue, human placenta tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman tonsillitis tissue, human liver cancer tissue, human placenta tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14486-1-AP targets CD34 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, pig, rabbit, bovine, goat, sheep
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5887

Product name: Recombinant human CD34 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 34-287 aa of BC039146

Sequence: DNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYS

Predict reactive species
Full Name CD34 molecule
Calculated Molecular Weight 41 kDa
Observed Molecular Weight 100-120 kDa
GenBank Accession NumberBC039146
Gene Symbol CD34
Gene ID (NCBI) 947
RRIDAB_2228975
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP28906
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD34 is a 105- to 120-kDa glycophosphoprotein expressed on the majority of hematopoietic stem/progenitor cells, bone marrow stromal cells, capillary endothelial cells, embryonic fibroblasts, and some nerve tissue. CD34 is a commonly used marker for identifying human hematopoietic stem/progenitor cells and mediates cell adhesion and lymphocyte homing by binding L-selectin and E-selectin ligands. CD34 is also one of the best negative selection markers for characterizing and/or isolating human MSCs from bone marrow and other sources. Along with other positive selection markers (such as CD29, CD44, CD90, CD105 and CD166), negative selection markers (such as CD34 and CD45) are used for MSC identification. The calculated molecular mass of human CD34 is 41 kDa, various forms with different molecular weights may be produced due to different glycosylation patterns and alternative splicing (PMID: 24375067; 15750786).

Protocols

Product Specific Protocols
IF protocol for CD34 antibody 14486-1-APDownload protocol
IHC protocol for CD34 antibody 14486-1-APDownload protocol
WB protocol for CD34 antibody 14486-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanIF

Mol Cancer

m6A methylation reader IGF2BP2 activates endothelial cells to promote angiogenesis and metastasis of lung adenocarcinoma

Authors - Han Fang
humanIHC

J Hepatol

Intratumoral neutrophils: a poor prognostic factor for hepatocellular carcinoma following resection.

Authors - Li Yi-Wei YW
rabbitIHC

Bioact Mater

Novel magnetic silk fibroin scaffolds with delayed degradation for potential long-distance vascular repair.

Authors - Xin Liu
IF

Bioact Mater

Bioactive vascular buds promote collateral vessel formation by grafting on the artificial vessel walls

Authors - Yulian Yang
humanWB

Nat Commun

ICAM1 initiates CTC cluster formation and trans-endothelial migration in lung metastasis of breast cancer.

Authors - Rokana Taftaf
humanIHC

Nat Commun

A transcriptome based molecular classification scheme for cholangiocarcinoma and subtype-derived prognostic biomarker

Authors - Zhongqi Fan

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Madan Kumar (Verified Customer) (07-13-2021)

Rat primary hepatocyte cells were subjected to SDS PAGE and performed western blot analysis with CD34 antibody (Cat log# 14486-1-AP). This antibody works good.

  • Applications: Western Blot, Cell culture
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Rat primary hepatocyte cells
Loading...
||
New chat

Able™

正在加载,请稍候...