CD33 Monoclonal antibody

• 

  WB analysis of Mo7e using 67135-2-Ig

  Mo7e cells were subjected to SDS PAGE followed by western blot with 67135-2-Ig (CD33 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of U-937 using 67135-2-Ig

  U-937 cells were subjected to SDS PAGE followed by western blot with 67135-2-Ig (CD33 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of THP-1 using 67135-2-Ig

  THP-1 cells were subjected to SDS PAGE followed by western blot with 67135-2-Ig (CD33 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

CD33 Monoclonal Antibody for WB, ELISA

Cat No. 67135-2-Ig

Clone No.1B3G4

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

WB, ELISA

Synonyms

CD33, CD33 molecule, FLJ00391, gp67, p67, SIGLEC 3, SIGLEC3

---

Tested Applications

• Positive WB detected in: Mo7e cells, THP-1 cells, U-937 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67135-2-Ig targets CD33 in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11402

  Product name: Recombinant human CD33 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 49-259 aa of BC028152

  Sequence: YYDKNSPVHGYWFREGAIISGDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH

• Full Name: CD33 molecule
• Calculated Molecular Weight: 364 aa, 40 kDa
• Observed Molecular Weight: 67-70 kDa
• GenBank Accession Number: BC028152
• Gene Symbol: CD33
• Gene ID (NCBI): 945
• RRID: AB_3085036
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P20138
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD33, also referred to as Siglec-3, is a 67-kDa glycosylated transmembrane protein of sialic acid-binding immunoglobulin-like lactic (siglec) family. CD33 is expressed on monocytes, myeloid progenitors, granulocytes, mast cells, some T cells. It may mediate cell-to-cell adhesion and act as a receptor that inhibits the proliferation of normal and leukemic myeloid cells.