CD31 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 80530-1-RR (same clone as 80530-1-PBS)

  Untreated and PNGase F-treated lysates of human peripheral blood platelets were subjected to SDS PAGE followed by western blot with 80530-1-RR (CD31 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 80530-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 80530-1-RR (same clone as 80530-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 80530-1-RR (CD31 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 80530-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 80530-1-RR (same clone as 80530-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 80530-1-RR (CD31 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80530-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 80530-1-RR (same clone as 80530-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 80530-1-RR (CD31 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80530-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HUVEC using 80530-1-RR (same clone as 80530-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HUVEC cells using CD31 antibody (80530-1-RR, Clone: 4N13 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 80530-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 80530-1-RR

  Biolayer interferometry (BLl) kinetic assays of 80530-1-RR against Human CD31 were performed. The affinity constant is below 1 pM.

CD31 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 80530-1-PBS

Clone No.4N13

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

4N13, EndoCAM, GPIIA, GPIIA', PECA1

---

Product Information

80530-1-PBS targets CD31 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1787

  Product name: Recombinant human CD31 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 428-738 aa of BC022512

  Sequence: EVRCESISGTLPISYQLLKTSKVLENSTKNSNDPAVFKDNPTEDVEYQCVADNCHSHAKMLSEVLRVKVIAPVDEVQISILSSKVVESGEDIVLQCAVNEGSGPITYKFYREKEGKPFYQMTSNATQAFWTKQKANKEQEGEYYCTAFNRANHASSVPRSKILTVRVILAPWKKGLIAVVIIGVIIALLIIAAKCYFLRKAKAKQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVGNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT

• Full Name: platelet/endothelial cell adhesion molecule
• Calculated Molecular Weight: 83 kDa
• Observed Molecular Weight: 130 kDa
• GenBank Accession Number: BC022512
• Gene Symbol: CD31
• Gene ID (NCBI): 5175
• ENSEMBL Gene ID: ENSG00000261371
• RRID: AB_2918900
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P16284
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Platelet endothelial cell adhesion molecule-1 (PECAM-1, CD31) is a member of the immunoglobulin gene superfamily of cell adhesion molecules. CD31 is a transmembrane glycoprotein that is highly expressed on the surface of the endothelium, making up a large portion of its intracellular junctions. PECAM-1 is also present on the surface of hematopoietic cells and immune cells including platelets, monocytes, neutrophils, natural killer cells, megakaryocytes and some types of T-cell (PMID: 9011572). As well as its role in cell-cell adhesion, PECAM-1 functions as a signaling receptor, and is involved in important physiological events such as nitric oxide production, regulation of T-cell immunity and tolerance, leukocyte transendothelial migration and inflammation and angiogenesis (PMID: 21183735; 20978210; 17872453; 20634489).