Use Able AI chat for product recommendations

CD247 Polyclonal antibody

CD247 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA
For FC, select conjugated version.

CD247 molecule, CD3 ZETA, CD3H, CD3Q, CD3Z

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for CD247 in ?

Tested Applications

Positive WB detected inJurkat cells, human spleen tissue, mouse spleen tissue
Positive IP detected inJurkat cells
Positive IHC detected inhuman tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inJurkat cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12837-2-AP targets CD247 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3889

Product name: Recombinant human CD247 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 50-164 aa of BC025703

Sequence: FLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR

Predict reactive species
Full Name CD247 molecule
Calculated Molecular Weight 16 kDa
Observed Molecular Weight 16 kDa
GenBank Accession NumberBC025703
Gene Symbol CD247
Gene ID (NCBI) 919
RRIDAB_2244279
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP20963
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD247, also known as CD3Z (T-cell surface glycoprotein CD3 zeta chain), belongs to the CD3Z/FCER1G family. CD3 is a complex of proteins that directly associates with the T cell receptor (TCR). The TCR/CD3 complex of T-lymphocytes consists of either a TCR alpha/beta or TCR gamma/delta heterodimer coexpressed at the cell surface with the invariant subunits of CD3 labeled gamma, delta, epsilon, zeta, and eta. The TCR recognizes antigens bound to major histocompatibility complex (MHC) molecules. TCR-mediated peptide-MHC recognition is transmitted to the CD3 complex, leading to the intracellular signal transduction. CD3 is considered to be a pan-T cell marker for detection of normal and neoplastic T cells.

Protocols

Product Specific Protocols
IF protocol for CD247 antibody 12837-2-APDownload protocol
IHC protocol for CD247 antibody 12837-2-APDownload protocol
IP protocol for CD247 antibody 12837-2-APDownload protocol
WB protocol for CD247 antibody 12837-2-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The CD247 Polyclonal antibody (Cat# 12837-2-AP) has 14 citations spanning journals including Nature Biomedical Engineering, Nature Communications, Journal of Clinical Investigation, Cell Reports, Frontiers in Immunology, International Journal of Molecular Sciences, iScience, and others. Research fields covered include CAR-T cell therapy, T cell signaling and activation, oncology (glioblastoma, bladder cancer, B-cell lymphoma), multiple sclerosis, osteoarthritis, and TCR interactome proteomics.

SpeciesApplicationTitle
humanWB

Nat Biomed Eng

Targeting overexpressed antigens in glioblastoma via CAR T cells with computationally designed high-affinity protein binders

Authors - Zhen Xia
mouseWB

Nat Commun

Cell volume controlled by LRRC8A-formed volume-regulated anion channels fine-tunes T cell activation and function

Authors - Yuman Wang

J Clin Invest

ANKRD55 is a key regulator of T cell inflammation in multiple sclerosis

Authors - Chuyu Wu
humanWB,IP

Cell Rep

Targeting protein tyrosine phosphatases for CDK6-induced immunotherapy resistance

Authors - Xueliang Gao
humanWB

Front Immunol

The Transferrin Receptor-Directed CAR for the Therapy of Hematologic Malignancies.

Authors - Zilong Guo
humanWB

Front Immunol

Efficacy and safety evaluation of cross-reactive Fibroblast activation protein scFv-based CAR-T cells

Authors - Wenhao Niu

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

One reviewer rated this antibody 5 stars, using it at a 1:1000 dilution for Western Blot and Immunoprecipitation on a leukemia cell line. They noted that the antibody is specific for human CD3 zeta protein, confirming its reliable performance and specificity in these applications.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Haizhen (Verified Customer) (10-15-2019)

specific for human CD3 zeta protein

  • Applications: Western Blot, Immunoprecipitation,
  • Primary Antibody Dilution: 1:1000 for western blot
  • Cell Tissue Type: leukemia cell line
Loading...
||
New chat

Able™

正在加载,请稍候...