• Featured Product
  • KD/KO Validated

CD18 Polyclonal antibody

CD18 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA
Cat No. 10554-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IF-P, ELISA

ITGB2, Cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta, Integrin beta 2, Integrin beta-2, LAD

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inU-937 cells
Positive IHC detected inhuman tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman tonsillitis tissue
Positive IF/ICC detected inTHP-1 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10554-1-AP targets CD18 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0861

Product name: Recombinant human CD18 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 469-769 aa of BC005861

Sequence: ICRCDTGYIGKNCECQTQGRSSQELEGSCRKDNNSIICSGLGDCVCGQCLCHTSDVPGKLIYGQYCECDTINCERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQCERTTEGCLNPRRVECSGRGRCRCNVCECHSGYQLPLCQECPGCPSPCGKYISCAECLKFEKGPFGKNCSAACPGLQLSNNPVKGRTCKERDSEGCWVAYTLEQQDGMDRYLIYVDESRECVAGPNIAAIVGGTVAGIVLIGILLLVIWKALIHLSDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES

Predict reactive species
Full Name integrin, beta 2 (complement component 3 receptor 3 and 4 subunit)
Calculated Molecular Weight 85 kDa
Observed Molecular Weight 85-90 kDa
GenBank Accession NumberBC005861
Gene Symbol CD18
Gene ID (NCBI) 3689
ENSEMBL Gene IDENSG00000160255
RRIDAB_2877736
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP05107
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD18, also known as integrin beta-2, is a transmembrane protein that forms heterodimers with CD11a, CD11b, CD11c, CD11d (PMID: 1968349). CD11a/CD18 (LFA-1) is expressed by all leukocytes, while CD11b/CD18 (Mac-1) and CD11c/CD18 (p150,95) are normally restricted to expression on monocytes, macrophages, polymorphonuclear lymphocytes (PMNs), and natural killer cells (PMID: 1968349; 3109455; 10946284). CD18 plays an important role in mediating cell adhesion during immune response and defects of CD18 cause leukocyte adhesion deficiency (PMID: 3594570).

Protocols

Product Specific Protocols
IF protocol for CD18 antibody 10554-1-APDownload protocol
IHC protocol for CD18 antibody 10554-1-APDownload protocol
WB protocol for CD18 antibody 10554-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
human

J Exp Med

Layilin augments integrin activation to promote antitumor immunity.

Authors - Kelly M Mahuron
pigIF

Research (Wash D C)

Regulating Blood Clot Fibrin Films to Manipulate Biomaterial-Mediated Foreign Body Responses

Authors - Yang Zou
humanWB,IF

ACS Appl Mater Interfaces

Leukocyte-Mediated Combined Targeted Chemo and Gene Therapy for Esophageal Cancer.

Authors - Yali Jun
humanWB,IHC,IF

Theranostics

ITGB2-mediated metabolic switch in CAFs promotes OSCC proliferation by oxidation of NADH in mitochondrial oxidative phosphorylation system.

Authors - Xiaoxin Zhang
  • KD Validated
humanWB

Int J Biol Macromol

Diethylaminoethyl-dextran and monocyte cell membrane coated 1,8-cineole delivery system for intracellular delivery and synergistic treatment of atherosclerosis

Authors - Feng Jiang
WB

Cardiovasc Res

Myocardin-related transcription factor A (MRTF-A) regulates integrin beta 2 transcription to promote macrophage infiltration and cardiac hypertrophy in mice.

Authors - Li Liu
Loading...
||
New chat Able
正在加载,请稍候...