CD16 Monoclonal antibody, PBS Only

• 

  IHC staining of human liver using 66779-1-Ig (same clone as 66779-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66779-1-Ig (CD16 antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66779-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 66779-1-Ig (same clone as 66779-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66779-1-Ig (CD16 antibody) at dilution of 1:5000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66779-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 66779-1-Ig (same clone as 66779-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66779-1-Ig (CD16 antibody) at dilution of 1:6000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66779-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human tonsillitis using 66779-1-Ig (same clone as 66779-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human tonsillitis tissue using CD16 antibody (66779-1-Ig, Clone: 1E12E11 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66779-1-PBS in a different storage buffer formulation.

CD16 Monoclonal Antibody for IHC, IF-P, ELISA

Cat No. 66779-1-PBS

Clone No.1E12E11

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IHC, IF-P, ELISA

Synonyms

1E12E11, CD16A, CD16a antigen, CD16-II, Fc gamma RIII

---

Product Information

66779-1-PBS targets CD16 in IHC, IF-P, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9787

  Product name: Recombinant human CD16 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 29-254 aa of BC017865

  Sequence: FLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGLYFSVKTNIRSSTRDWKDHKFKWRKDPQDK

• Full Name: Fc fragment of IgG, low affinity IIIa, receptor (CD16a)
• Calculated Molecular Weight: 254 aa, 29 kDa
• GenBank Accession Number: BC017865
• Gene Symbol: CD16a
• Gene ID (NCBI): 2214
• ENSEMBL Gene ID: ENSG00000203747
• RRID: AB_2918477
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P08637
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD16 is a 50-70-kDa low affinity Fc receptor found on the surface of natural killer cells, neutrophil polymorphonuclear leukocytes, monocytes and macrophages. CD16 mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis. CD16 has been identified as Fc receptors FcγRIIIa (CD16a) and FcγRIIIb (CD16b), encoded by two nearly identical genes, FCGR3A and the FCGR3B.