Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CD147 Polyclonal antibody

CD147 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 30880-1-AP
Reviews (1)
Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

5F7, Basigin, BSG, Collagenase stimulatory factor, EMMPRIN

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for CD147 in ?

Tested Applications

Positive WB detected inJurkat cells, HepG2 cells
Positive IHC detected inhuman placenta tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:4000-1:16000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

30880-1-AP targets CD147 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Eg0436

Product name: Recombinant Human CD147 protein (His Tag)(HPLC verified)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 138-323 aa of BC009040

Sequence: EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLA

Predict reactive species
Full Name basigin (Ok blood group)
Calculated Molecular Weight 385 aa, 42 kDa
Observed Molecular Weight35-55 kDa
GenBank Accession NumberBC009040
Gene Symbol CD147
Gene ID (NCBI) 682
RRIDAB_3669773
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP35613
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD147, also known as Basigin or extracellular matrix metalloproteinase inducer (EMMPRIN), is a transmembrane glycoprotein that belongs to the immunoglobulin superfamily (PMID: 7812975). The molecule is composed of an intracellular portion, an extracellular portion and a single transmembrane region. CD147 is expressed on a variety of cell types (e.g., hematopoietic, epithelial, and endothelial cells) and at varying levels (PMID: 32968061). Increased expression of CD147 occurs in many tumors. CD147 is a pleiotropic molecule that plays an important role in fetal, neuronal, lymphocyte and extracellular matrix development (PMID: 17945211). CD147 has been identified as a receptor essential for erythrocyte invasion by Plasmodium falciparum (PMID: 22080952). It has been reported that spike protein of SARS-CoV-2 binds to CD147 on host cells, thereby mediating the viral invasion (Wang, Ke, et al, BioRxiv, 2020).

Protocols

Product Specific Protocols
IF protocol for CD147 antibody 30880-1-APDownload protocol
IHC protocol for CD147 antibody 30880-1-APDownload protocol
WB protocol for CD147 antibody 30880-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The product has one review from a user who used it at a 1:1000 dilution on human cell lines for Western Blot. The reviewer gave it a perfect 5-star rating and simply stated "It worked great." Overall, the limited feedback is positive, with the user reporting successful performance in their WB application.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Lili (Verified Customer) (01-28-2026)

It worked great.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Human cell lines
Loading...
||
New chat

Able™

正在加载,请稍候...