Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CCPG1 Polyclonal antibody

CCPG1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF/ICC, IP, ELISA

CCP8, CPR8, KIAA1254

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for CCPG1 in ?

Tested Applications

Positive WB detected inHepG2 cells, L02 cells, THP-1 cells
Positive IP detected inHepG2 cells
Positive IHC detected inhuman stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13861-1-AP targets CCPG1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4841

Product name: Recombinant human CCPG1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 264-613 aa of BC034914

Sequence: LHGKSDSPNVYTEKKEIAILRERLTELELKLTFEQQRSDLWERLYVEAKDQNGKQGTDGKKKGGRGSHRAKNKSKETFLGSVKETFDAMKNSTKEFVRHHKEKIKQAKEAVKENLKKFSDSVKSTFRHFKDTTKNIFDEKGNKRFGATKEAAEKPRTVFSDYLHPQYKAPTENHHNRGPTMQNDGRKEKPVHFKEFRKNTNSKKCSPGHDCRENSHSFREACSGVFDCAQQESMSLFNIVVNPIRMDEFRQIIQRYMLKELDTFCHWNELDQFINKFFLNGVFIHDQKLFTDFVNDVKDYLRNMKEYEVDNDGVFEKLDEYIYRHFFGHTFSPPYGPRSVYIKPCHYSSL

Predict reactive species
Full Name cell cycle progression 1
Calculated Molecular Weight 87 kDa
Observed Molecular Weight110 kDa
GenBank Accession NumberBC034914
Gene Symbol CCPG1
Gene ID (NCBI) 9236
RRIDAB_2074010
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9ULG6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cell-cycle progression gene 1 (CCPG1) is a receptor for ER stress-induced ER-phagy. CCPG1 localizes to perinuclear ER and in small foci at the ER periphery. It contains a LIR at the N-terminal cytosolic domain engaging LC3/GABARAP. (PMID: 29802216, PMID: 29290589)

Protocols

Product Specific Protocols
IF protocol for CCPG1 antibody 13861-1-APDownload protocol
IHC protocol for CCPG1 antibody 13861-1-APDownload protocol
IP protocol for CCPG1 antibody 13861-1-APDownload protocol
WB protocol for CCPG1 antibody 13861-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Anti-FAM134B (CCPG1) antibody, catalog number 13861-1-AP, has 32 citations published in journals including Nature Cell Biology, Autophagy, Nature Communications, Molecular Cell, Developmental Cell, EMBO Journal, Cancer Letters, Redox Biology, Phytomedicine, and others. Research fields span ER-phagy/reticulophagy, ER stress, autophagy, neurodegeneration (Parkinson's disease), cancer (bladder, lung, breast, hepatocellular, glioblastoma), viral pathogenicity, cardiotoxicity, and innate immunity.

SpeciesApplicationTitle
humanWB

Nat Cell Biol

Cholesterol sensing by the SCAP-FAM134B complex regulates ER-phagy and STING innate immunity.

Authors - Boran Li
humanWB

Autophagy

ATF4 links ER stress with reticulophagy in glioblastoma cells.

Authors - Svenja Zielke
human, mouseWB,IHC

Autophagy

CCPG1-mediated reticulophagy promotes tumorigenesis and cisplatin resistance in bladder cancer.

Authors - Yang Dong
  • KD Validated
mouse,humanWB

Autophagy

RETREG1-mediated reticulophagy is activated by an ATF4-CEBPG/C/EBPγ heterodimer and confers protection against lipotoxicity

Authors - Suwei Jin
humanWB

Nat Commun

AMFR-mediated Flavivirus NS2A ubiquitination subverts ER-phagy to augment viral pathogenicity

Authors - Linliang Zhang
mouseWB

Redox Biol

Adaptive responses of neuronal cells to chronic endoplasmic reticulum (ER) stress

Authors - Thu Nguyen Minh Pham

Reviews

    2.5 out of 5
Add a review

2 verified customer reviews

What customers say

Both reviewers used this antibody for Western Blot at a 1:1000 dilution and reported significant background issues. One user observed multiple nonspecific bands between 40–70 kDa in pancreas and liver tissues (3/5 rating). The other noted heavy background in HCT116 cells and had to perform an siRNA knockdown experiment to confirm that the band near 98 kDa was the true CCPG1 signal (2/5 rating). Overall, users found the antibody produced considerable nonspecific binding, requiring additional validation to identify the correct target band.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Zhe (Verified Customer) (09-12-2025)

There are several nonspecific bands showing up between 40-70kDa

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: pancreas, liver

H (Verified Customer) (04-05-2020)

This antibody has lots of background bands. In the beginning, I was not sure which band is the right band. In the end, I performed knock-down experiment using siRNA, and validated that the band close to 98 kDa is the CCPG1 band.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HCT116
CCPG1 Antibody Western Blot validation (1:1000 dilution) in HCT116 (Cat no:13861-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...